Property Summary

NCBI Gene PubMed Count 35
PubMed Score 52.46
PubTator Score 26.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -2.700 1.0e-03
astrocytic glioma -2.900 1.6e-03
Astrocytoma, Pilocytic -3.100 1.1e-06
atypical teratoid / rhabdoid tumor -3.200 9.1e-10
cutaneous lupus erythematosus -1.500 8.0e-04
Down syndrome -1.100 3.1e-02
ependymoma -3.400 1.6e-03
glioblastoma -2.800 2.8e-08
group 3 medulloblastoma -2.600 1.2e-02
interstitial cystitis -1.600 3.8e-02
intraductal papillary-mucinous carcinoma... 1.700 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.300 3.3e-03
lung cancer -1.900 6.1e-05
lung carcinoma 3.400 1.9e-53
medulloblastoma, large-cell -3.600 5.0e-07
nephrosclerosis -1.379 1.5e-02
non diabetic and post-ischemic heart fai... 1.200 9.3e-03
oligodendroglioma -2.100 1.4e-02
Pick disease -1.700 1.9e-03
primitive neuroectodermal tumor -2.800 2.5e-04
sarcoidosis -1.100 2.2e-02
severe Alzheimer's disease -1.423 2.5e-02
subependymal giant cell astrocytoma -2.210 3.1e-02
urothelial carcinoma -1.400 1.8e-05

Gene RIF (13)

AA Sequence

MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAED      1 - 70
ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLC     71 - 140
ILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEP    141 - 210
ILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVK    211 - 280
PAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK                                        281 - 314
//

Text Mined References (39)

PMID Year Title