Property Summary

NCBI Gene PubMed Count 35
Grant Count 2
Funding $182,250
PubMed Score 50.67
PubTator Score 26.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14894 D5MNX0 Q5HYB7
Symbols THBP
DFNA40

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

2I99  

Gene RIF (13)

PMID Text
26173510 These findings confirm that, mechanistically, ketimine reductase/CRYM acts as a classical imine reductase and may explain the finding of bound pyruvate in the crystallized protein.
25931162 ketimine reductase is a key enzyme in the pipecolate pathway, which is the main lysine degradation pathway in the brain
23508717 The expression of mu-crystallin was regulated through the AP-1 site in the promoter.
21332720 The purified human mu-crystallin was confirmed to have ketimine reductase activity with a maximum specific activity similar to that of native ovine ketimine reductase
21332720 Its ketimine reductase activity is strongly inhibited by thyroid hormones.
21332720 Its enzyme function has been determined as a ketimine reductase in mammalian brain.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20018174 This is the first report linking hyperglycemia with thyroid hormone binding protein CRYM and suggests that the role of CRYM in diabetic complications should be further investigated.
19353593 CRYM is a novel androgen-regulated gene whose expression is elevated in prostate cancer but down-regulated in castration therapy-resistant tumors.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
More...

AA Sequence

MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAED      1 - 70
ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLC     71 - 140
ILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEP    141 - 210
ILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVK    211 - 280
PAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK                                        281 - 314
//

Text Mined References (39)

PMID Year Title
26173510 2015 Ketimine reductase/CRYM catalyzes reductive alkylamination of ?-keto acids, confirming its function as an imine reductase.
25931162 2015 Insights into Enzyme Catalysis and Thyroid Hormone Regulation of Cerebral Ketimine Reductase/?-Crystallin Under Physiological Conditions.
25057873 2014 Adipose tissue ?-crystallin is a thyroid hormone-binding protein associated with systemic insulin sensitivity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23508717 2013 Possible roles of the AP-1 site in the cytosolic T3 binding protein promoter and insights into its physiological significance.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21418222 2011 Crystallin-gazing: unveiling enzymatic activity.
21332720 2011 Mammalian forebrain ketimine reductase identified as ?-crystallin; potential regulation by thyroid hormones.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
More...