Property Summary

NCBI Gene PubMed Count 41
PubMed Score 100.96
PubTator Score 104.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 1.8e-06
ovarian cancer 8520 3.7e-05
medulloblastoma, large-cell 6241 1.5e-04
osteosarcoma 7950 3.6e-04
acute myeloid leukemia 783 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hypothyroidism 122 0.0 0.7
Disease Target Count Z-score Confidence
Enamel erosion 19 4.648 2.3
Dentine erosion 3 4.279 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 1.400 2.2e-02
medulloblastoma, large-cell -1.300 1.5e-04
osteosarcoma -1.127 3.6e-04
ovarian cancer -1.100 3.7e-05
tuberculosis -1.200 1.8e-06

 GO Component (2)

Gene RIF (25)

AA Sequence

MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCGEH      1 - 70
LPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY     71 - 140
QCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTKEKPFECDVQGCEKA    141 - 210
FNTLYRLKAHQRLHTGKTFNCESEGCSKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHV    211 - 280
RTHTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSEL    281 - 350
RENSSTTQGQDLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLP    351 - 420
LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQ    421 - 490
APQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAI    491 - 560
LQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEE    561 - 630
ACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQ    631 - 700
AETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK                     701 - 753
//

Text Mined References (42)

PMID Year Title