Property Summary

NCBI Gene PubMed Count 40
Grant Count 58
R01 Count 50
Funding $5,796,555.92
PubMed Score 96.62
PubTator Score 104.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.127 0.000
medulloblastoma, large-cell -1.300 0.000
tuberculosis -1.200 0.000
acute myeloid leukemia 1.400 0.022
ovarian cancer 1.300 0.003

Gene RIF (24)

PMID Text
26529669 Forty-one single nucleotide polymorphisms (SNPs) within the MTF1 gene region.
26336656 MTF-1 has a role in regulating zinc dependent cellular processes at the molecular level [review]
25618524 Human ZnT2 expression is regulated by MTF-1.
25162517 Zn-responsive proteome profiling and time-dependent expression of proteins are regulated by MTF-1 in human alveolar epithelial cells.
23368743 The zinc-sensing cytoplasmic transcription factor MTF-1 plays a key role in cellular zinc homoeostasis.
22057392 Results identify a cysteine cluster that mediates homodimerization of human MTF-1, and show that dimer formation in vivo is important for basal and especially metal-induced transcriptional activity.
22021037 It is concluded that SUMO conjugation and the SIM on MTF-1 do not play a critical role in suppressing transcriptional activity. Instead, MTF-1 forms complexes with cellular factors through SIM and SUMO moiety in the cytoplasm
21798283 Variations in the ability of LAT1/DMT1/MTF1/MT1a to process and transport Hg may not play a significant role in the etiology of autism.
21386983 Transcriptional regulation of the beta-synuclein 5'-promoter metal response element by metal transcription factor-1.
20688958 Zinc and cadmium can activate FPN1 transcription through the MTF-1.
More...

AA Sequence

MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCGEH      1 - 70
LPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY     71 - 140
QCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTKEKPFECDVQGCEKA    141 - 210
FNTLYRLKAHQRLHTGKTFNCESEGCSKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHV    211 - 280
RTHTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSEL    281 - 350
RENSSTTQGQDLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLP    351 - 420
LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQ    421 - 490
APQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAI    491 - 560
LQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEE    561 - 630
ACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQ    631 - 700
AETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK                     701 - 753
//

Text Mined References (41)

PMID Year Title
26529669 2015 Genetic variation in metallothionein and metal-regulatory transcription factor 1 in relation to urinary cadmium, copper, and zinc.
26336656 2015 Metal responsive transcription factor 1 (MTF-1) regulates zinc dependent cellular processes at the molecular level.
25618524 2015 Coordinative modulation of human zinc transporter 2 gene expression through active and suppressive regulators.
25162517 2014 Zn-responsive proteome profiling and time-dependent expression of proteins regulated by MTF-1 in A549 cells.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23368743 2013 Zinc-dependent lysosomal enlargement in TRPML1-deficient cells involves MTF-1 transcription factor and ZnT4 (Slc30a4) transporter.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22057392 2012 A conserved cysteine cluster, essential for transcriptional activity, mediates homodimerization of human metal-responsive transcription factor-1 (MTF-1).
22021037 2011 The role of small ubiquitin-like modifier-interacting motif in the assembly and regulation of metal-responsive transcription factor 1.
More...