Property Summary

NCBI Gene PubMed Count 65
PubMed Score 54.60
PubTator Score 48.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.519 1.5e-04
Breast cancer 2.400 2.6e-02
breast carcinoma -1.400 8.3e-05
cystic fibrosis -1.581 5.8e-06
dermatomyositis 1.300 2.3e-02
ependymoma -1.100 5.2e-03
intraductal papillary-mucinous adenoma (... -1.500 2.1e-02
intraductal papillary-mucinous carcinoma... -1.200 4.2e-02
invasive ductal carcinoma -1.149 2.4e-03
juvenile dermatomyositis 1.135 1.4e-08
lung cancer -1.100 8.7e-04
malignant mesothelioma -1.500 3.4e-07
medulloblastoma, large-cell -2.600 3.4e-05
ovarian cancer -2.000 1.5e-05
pancreatic cancer 1.600 6.5e-04
pituitary cancer -1.700 1.4e-07
primary pancreatic ductal adenocarcinoma 1.370 1.7e-03
sonic hedgehog group medulloblastoma -1.600 4.6e-04
ulcerative colitis 1.100 1.3e-02

 GO Component (2)

Gene RIF (41)

AA Sequence

MEPNSLQWVGSPCGLHGPYIFYKAFQFHLEGKPRILSLGDFFFVRCTPKDPICIAELQLLWEERTSRQLL      1 - 70
SSSKLYFLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHAGPVKTEALGRNGQK     71 - 140
EALLKYRQSTLNSGLNFKDVLKEKADLGEDEEETNVIVLSYPQYCRYRSMLKRIQDKPSSILTDQFALAL    141 - 210
GGIAVVSRNPQILYCRDTFDHPTLIENESICDEFAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGKAV    211 - 280
AKVKCEARSALTKPKNNHNCKKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIPYLGFKQI    281 - 350
NLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPI    351 - 420
KPRKQENSSQENENKTKVSGTKRIKHEIPKSKKEKENAPKPQDAAEVSSEQEKEQETLISQKSIPEPLPA    421 - 490
ADMKKKIEGYQEFSAKPLASRVDPEKDNETDQGSNSEKVAEEAGEKGPTPPLPSAPLAPEKDSALVPGAS    491 - 560
KQPLTSPSALVDSKQESKLCCFTESPESEPQEASFPSFPTTQPPLANQNETEDDKLPAMADYIANCTVKV    561 - 630
DQLGSDDIHNALKQTPKVLVVQSFDMFKDKDLTGPMNENHGLNYTPLLYSRGNPGIMSPLAKKKLLSQVS    631 - 700
GASLSSSYPYGSPPPLISKKKLIARDDLCSSLSQTHHGQSTDHMAVSRPSVIQHVQSFRSKPSEERKTIN    701 - 770
DIFKHEKLSRSDPHRCSFSKHHLNPLADSYVLKQEIQEGKDKLLEKRALPHSHMPSFLADFYSSPHLHSL    771 - 840
YRHTEHHLHNEQTSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSL    841 - 910
PKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHH    911 - 980
VRLENFRKMEGMVHPILHRKMSPQNIGAARPIKRSLEDLDLVIAGKKARAVSPLDPSKEVSGKEKASEQE    981 - 1050
SEGSKAAHGGHSGGGSEGHKLPLSSPIFPGLYSGSLCNSGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLA   1051 - 1120
FHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL     1121 - 1188
//

Text Mined References (74)

PMID Year Title