Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.16
PubTator Score 233.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.47529489202999E-87
posterior fossa group B ependymoma 1530 4.70839652233561E-9
ovarian cancer 8492 3.57420078902036E-8
atypical teratoid / rhabdoid tumor 4369 1.64203550076596E-7
osteosarcoma 7933 3.67692571443669E-7
pilocytic astrocytoma 3086 4.70211938745841E-7
medulloblastoma, large-cell 6234 1.62296941646672E-6
glioblastoma 5572 1.8525206336319E-6
malignant mesothelioma 3163 3.74796232252235E-5
adult high grade glioma 2148 7.89102994726229E-5
primitive neuroectodermal tumor 3031 2.04834510815309E-4
medulloblastoma 1524 6.91603203429984E-4
invasive ductal carcinoma 2950 0.00157514372546356
Breast cancer 3099 0.0297639540966396
Disease Target Count Z-score Confidence
Clear cell adenocarcinoma 2 4.513 2.3

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
osteosarcoma -3.356 0.000
posterior fossa group B ependymoma -2.000 0.000
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma -1.500 0.001
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -1.700 0.000
Breast cancer -2.700 0.030
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -1.900 0.000
invasive ductal carcinoma -1.400 0.002
ovarian cancer -1.100 0.000
psoriasis -1.100 0.000

Synonym

Accession Q14863 Q15944 Q6DK47 Q7Z7P6
Symbols BRN5
MPOU
TCFB1

Gene

PDB

3D1N  

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
20134265 POU6F1 siRNA dose-dependently suppressed the proliferation of clear cell adenocarcinoma cell lines.
19874398 is the transcription factor that might be involved in cell proliferation of clear cell adenocarcinoma of the ovary.
19450691 The crystal structure of human Brn-5 transcription factor in complex with corticotropin-releasing hormone gene promoter reveals an unexpected recognition mode of the protein to its cognate DNA
18976975 Knockdown of POU class 6 homeobox 1 (POU6F1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18323601 Crystallization and preliminary X-ray analysis

AA Sequence

MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAV      1 - 70
RKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDED     71 - 140
GINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLN    141 - 210
EAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRV    211 - 280
WFCNRRQTLKNTSKLNVFQIP                                                     281 - 301
//

Text Mined References (14)

PMID Year Title
20134265 2010 Transcription factor POU6F1 is important for proliferation of clear cell adenocarcinoma of the ovary and is a potential new molecular target.
19874398 2009 POU6F1 is the transcription factor that might be involved in cell proliferation of clear cell adenocarcinoma of the ovary.
19450691 2009 Structure of human Brn-5 transcription factor in complex with CRH gene promoter.
18323601 2008 Crystallization and preliminary X-ray analysis of human Brn-5 transcription factor in complex with DNA.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
More...