Property Summary

NCBI Gene PubMed Count 15
PubMed Score 21.39
PubTator Score 233.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 3.2e-04
Astrocytoma, Pilocytic -1.800 8.1e-07
atypical teratoid / rhabdoid tumor -1.900 1.3e-10
Breast cancer -2.700 3.0e-02
ependymoma -1.900 7.8e-10
glioblastoma -1.600 3.6e-07
invasive ductal carcinoma -1.100 7.0e-05
malignant mesothelioma -1.200 3.7e-05
medulloblastoma -1.200 9.4e-06
medulloblastoma, large-cell -1.900 7.1e-07
osteosarcoma -1.489 6.4e-04
ovarian cancer -1.100 3.6e-08
primitive neuroectodermal tumor -1.700 2.0e-04
psoriasis -1.100 2.5e-87

Gene RIF (5)

AA Sequence

MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAV      1 - 70
RKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDED     71 - 140
GINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLN    141 - 210
EAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRV    211 - 280
WFCNRRQTLKNTSKLNVFQIP                                                     281 - 301
//

Text Mined References (15)

PMID Year Title