Property Summary

NCBI Gene PubMed Count 45
PubMed Score 39.37
PubTator Score 44.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count
cocaine use 11
Disease Target Count Z-score Confidence
Retinitis pigmentosa 23 27 3.494 1.7

Expression

Gene RIF (26)

AA Sequence

MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWII      1 - 70
ELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVI     71 - 140
LSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSP    141 - 210
PESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHG    211 - 280
KTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNV    281 - 350
RRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIH    351 - 420
QSLAATMFEFAFHLRQRISELGARA                                                 421 - 445
//

Text Mined References (48)

PMID Year Title