Property Summary

NCBI Gene PubMed Count 41
Grant Count 10
Funding $300,494.37
PubMed Score 36.80
PubTator Score 44.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Prostatic Neoplasms 471

Expression

 GO Function (1)

Gene RIF (22)

PMID Text
25681734 Elevated StARD3 expression may contribute to breast cancer aggressiveness by increasing membrane cholesterol and enhancing oncogenic signaling.
25459514 Data indicate that mitochondrial proteolytic activation of START domain-containing protein 3 (STARD3) enhances steroidogenesis.
24291029 Haplotype analysis indicated that combined effect of STARD3 variants (rs9972882, rs881844, rs11869286 and rs1877031) might affect the risk of GC.
24276243 Findings show that PPP1R1B-STARD3 fusion transcript has a key role in subsets of gastric cancers through the activation of PI3K/AKT signaling.
24105263 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the endoplasmic reticulum.
21322544 data indicate that StARD3 is the primary lutein-binding protein in macula lutea; recombinant StARD3 selectively binds lutein with high affinity
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20198306 FAK contributed to the increased adhesion in MDA-MB-231DeltaMLN64 cells.
19965586 a transport pathway for endosomal cholesterol to mitochondria that requires MLN64, but not NPC1
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWII      1 - 70
ELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVI     71 - 140
LSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSP    141 - 210
PESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHG    211 - 280
KTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNV    281 - 350
RRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIH    351 - 420
QSLAATMFEFAFHLRQRISELGARA                                                 421 - 445
//

Text Mined References (42)

PMID Year Title
25681734 2015 Elevated levels of StAR-related lipid transfer protein 3 alter cholesterol balance and adhesiveness of breast cancer cells: potential mechanisms contributing to progression of HER2-positive breast cancers.
25459514 2015 Mitochondrial proteases act on STARD3 to activate progesterone synthesis in human syncytiotrophoblast.
25416956 2014 A proteome-scale map of the human interactome network.
24291029 2014 Association analysis of ERBB2 amplicon genetic polymorphisms and STARD3 expression with risk of gastric cancer in the Chinese population.
24276243 2014 PPP1R1B-STARD3 chimeric fusion transcript in human gastric cancer promotes tumorigenesis through activation of PI3K/AKT signaling.
24105263 2013 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
21322544 2011 Identification of StARD3 as a lutein-binding protein in the macula of the primate retina.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...