Property Summary

NCBI Gene PubMed Count 65
Grant Count 25
R01 Count 23
Funding $1,658,320.74
PubMed Score 68.02
PubTator Score 64.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

 GO Process (1)

Pathway (1)

Gene RIF (46)

PMID Text
26797416 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26683818 LASP-1, mediated by miR-203, has crucial functions in the proliferation, migration and invasion of human non-small cell lung cancer
26414725 It is a target gene of miR-1.
26232936 Detecting an affection of migratory processes after LASP-1 silencing, we propose that LASP-1 could impact on metastasis of CC [choriocarcinoma]cells.
26061439 Results identified LASP1 as a hitherto unknown protein in melanocytes and as novel partner of dynamin in the physiological process of membrane constriction and melanosome vesicle release.
25982273 LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays
25760690 Our results suggest that LASP-1 mRNA overexpression may be mainly implicated in female hepatocellular carcinoma (HCC) and cirrhotic HCCs; and that LASP1 may play its role with vimentin in HCC cells.
25622104 LASP1 plays key roles in cell structure, physiological processes, and cell signaling; overexpression contributes to cancer aggressiveness [review]
25385028 Results defined LASP1 as a direct target gene for HIF1alpha upregulation that is critical for metastatic progression of PDAC.
25252758 LIM and SH3 protein 1 induces TGFbeta-mediated epithelial-mesenchymal transition in human colorectal cancer by regulating S100A4 expression.
More...

AA Sequence

MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE      1 - 70
NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME     71 - 140
PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV    141 - 210
YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI                       211 - 261
//

Text Mined References (78)

PMID Year Title
26797416 2016 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26683818 2016 LASP-1, regulated by miR-203, promotes tumor proliferation and aggressiveness in human non-small cell lung cancer.
26414725 2016 The tumor-suppressive function of miR-1 by targeting LASP1 and TAGLN2 in esophageal squamous cell carcinoma.
26232936 2016 The cytoskeletal protein LASP-1 differentially regulates migratory activities of choriocarcinoma cells.
26061439 2015 LASP1, a Newly Identified Melanocytic Protein with a Possible Role in Melanin Release, but Not in Melanoma Progression.
25982273 2016 LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25760690 2015 Molecular characterization of LASP-1 expression reveals vimentin as its new partner in human hepatocellular carcinoma cells.
25622104 2015 An update on the LIM and SH3 domain protein 1 (LASP1): a versatile structural, signaling, and biomarker protein.
More...