Property Summary

NCBI Gene PubMed Count 70
PubMed Score 77.54
PubTator Score 64.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Endometrial Neoplasms 55 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Cancer 2499 3.647 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 2.8e-02
autosomal dominant Emery-Dreifuss muscul... 1.155 3.9e-03
dermatomyositis 1.200 8.1e-03
Duchenne muscular dystrophy 1.293 4.2e-09
esophageal adenocarcinoma 1.200 2.1e-02
juvenile dermatomyositis 1.290 1.0e-10

Gene RIF (51)

AA Sequence

MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE      1 - 70
NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME     71 - 140
PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV    141 - 210
YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI                       211 - 261
//

Text Mined References (83)

PMID Year Title