Property Summary

NCBI Gene PubMed Count 65
PubMed Score 68.02
PubTator Score 64.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Autistic Disorder 320
Disease Target Count P-value
juvenile dermatomyositis 1189 1.02879227512943E-10
Duchenne muscular dystrophy 602 4.20597846534098E-9
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00385366586518948
dermatomyositis 967 0.00812155472129291
esophageal adenocarcinoma 737 0.0214186194211698
astrocytoma 1493 0.0276332171754889
Disease Target Count Z-score Confidence
Cancer 2346 3.449 1.7

Expression

  Differential Expression (6)

Synonym

Accession Q14847 B4DGQ0 Q96ED2 Q96IG0 LASP-1
Symbols MLN50
Lasp-1

Gene

PDB

3I35  

  Ortholog (11)

 GO Process (1)

Pathway (1)

Gene RIF (46)

PMID Text
26797416 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26683818 LASP-1, mediated by miR-203, has crucial functions in the proliferation, migration and invasion of human non-small cell lung cancer
26414725 It is a target gene of miR-1.
26232936 Detecting an affection of migratory processes after LASP-1 silencing, we propose that LASP-1 could impact on metastasis of CC [choriocarcinoma]cells.
26061439 Results identified LASP1 as a hitherto unknown protein in melanocytes and as novel partner of dynamin in the physiological process of membrane constriction and melanosome vesicle release.
25982273 LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays
25760690 Our results suggest that LASP-1 mRNA overexpression may be mainly implicated in female hepatocellular carcinoma (HCC) and cirrhotic HCCs; and that LASP1 may play its role with vimentin in HCC cells.
25622104 LASP1 plays key roles in cell structure, physiological processes, and cell signaling; overexpression contributes to cancer aggressiveness [review]
25385028 Results defined LASP1 as a direct target gene for HIF1alpha upregulation that is critical for metastatic progression of PDAC.
25252758 LIM and SH3 protein 1 induces TGFbeta-mediated epithelial-mesenchymal transition in human colorectal cancer by regulating S100A4 expression.
More...

AA Sequence

MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE      1 - 70
NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME     71 - 140
PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV    141 - 210
YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI                       211 - 261
//

Text Mined References (78)

PMID Year Title
26797416 2016 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26683818 2016 LASP-1, regulated by miR-203, promotes tumor proliferation and aggressiveness in human non-small cell lung cancer.
26414725 2016 The tumor-suppressive function of miR-1 by targeting LASP1 and TAGLN2 in esophageal squamous cell carcinoma.
26232936 2016 The cytoskeletal protein LASP-1 differentially regulates migratory activities of choriocarcinoma cells.
26061439 2015 LASP1, a Newly Identified Melanocytic Protein with a Possible Role in Melanin Release, but Not in Melanoma Progression.
25982273 2016 LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25760690 2015 Molecular characterization of LASP-1 expression reveals vimentin as its new partner in human hepatocellular carcinoma cells.
25622104 2015 An update on the LIM and SH3 domain protein 1 (LASP1): a versatile structural, signaling, and biomarker protein.
More...