Property Summary

NCBI Gene PubMed Count 63
Grant Count 63
R01 Count 38
Funding $7,724,810.87
PubMed Score 145.80
PubTator Score 60.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.003
malignant mesothelioma 1.200 0.000
psoriasis 1.400 0.003
osteosarcoma 1.947 0.000
astrocytoma 1.400 0.001
glioblastoma 1.300 0.000
medulloblastoma 1.100 0.001
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.200 0.000
lung adenocarcinoma 1.317 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q14839 Q8IXZ5 CHD-4
Symbols CHD-4
Mi-2b
SIHIWES
Mi2-BETA

Gene

PDB

1MM2   1MM3   2EE1   2L5U   2L75   2N5N   4O9I  

 GWAS Trait (1)

Gene RIF (21)

PMID Text
26827827 Specifically, methyl-CpG-binding domain protein 2 (MBD2) is revealed to be recruited to DNA damage sites after laser microirradiation, which was mediated through MBD domain and MBD2 C-terminus.
26565020 these data build on our understanding of how CHD4-NuRD acts to regulate gene expression and participates in the DNA-damage response.
26546801 Acetyltransferase p300 collaborates with chromodomain helicase DNA-binding protein 4 (CHD4) to facilitate DNA double-strand break repair
26296641 Also discovered a novel causative role for CHD4, a helicase involved in the histone deacetylase complex that is associated with poor clinical outcome.
26265695 CHD4 depletion modulates expression of acute myeloid leukemia cell genes that regulate tumor formation in vivo and colony formation in vitro.
25737278 CHD4 modulates therapeutic response in BRCA2 mutant cancer cells.
25407497 D140E SNP was associated with lung cancer, malignant lymphoma and rectum cancer and may interact with smoking habit to increase the risk.
24991957 Endogenous Mta1/2 forms a complex with chromodomain helicase (Chd)4, histone deacetylases (Hdac)1/2, RbAp46/48, and Mbd3 in rat cerebellum
23708667 CHD4 and HDAC1 occupy the promoters of several of these hypermethylated tumor suppressor genes and physically and functionally interact to maintain their silencing.
23071088 repressive functions of MBD2-containing NuRD complexes are dependent on cooperative interactions between the major domains of CHD4 with histones and DNA and on binding of methylated DNA by MBD2
More...

AA Sequence

MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKR      1 - 70
QKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEED     71 - 140
DDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWR    141 - 210
EFSTNNPFKGSSGASVAAAAAAAVAVVESMVTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRV    211 - 280
PDAKKPKPKKVAPLKIKLGGFGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTK    281 - 350
KKKKGEEEVTAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ    351 - 420
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLC    421 - 490
PRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSE    491 - 560
LQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNH    561 - 630
SVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERP    631 - 700
PETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYK    701 - 770
EGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE    771 - 840
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLE    841 - 910
ELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSP    911 - 980
MQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASG    981 - 1050
KLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQF   1051 - 1120
CFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKK   1121 - 1190
KMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR   1191 - 1260
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLA   1261 - 1330
RNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPL   1331 - 1400
PPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEP   1401 - 1470
GADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKT   1471 - 1540
PTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVE   1541 - 1610
PPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP   1611 - 1680
KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQ   1681 - 1750
DIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNT   1751 - 1820
RFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSER   1821 - 1890
NILSRLANRAPEPTPQQVAQQQ                                                   1891 - 1912
//

Publication (82)

PMID Year Title
27616479 2016 De Novo Mutations in CHD4, an ATP-Dependent Chromatin Remodeler Gene, Cause an Intellectual Disability Syndrome with Distinctive Dysmorphisms.
27235397 2016 CHD4 Is a Peripheral Component of the Nucleosome Remodeling and Deacetylase Complex.
26827827 2016 iTRAQ-based chromatin proteomic screen reveals CHD4-dependent recruitment of MBD2 to sites of DNA damage.
26565020 2016 The N-terminal Region of Chromodomain Helicase DNA-binding Protein 4 (CHD4) Is Essential for Activity and Contains a High Mobility Group (HMG) Box-like-domain That Can Bind Poly(ADP-ribose).
26546801 2016 Acetyltransferase p300 collaborates with chromodomain helicase DNA-binding protein 4 (CHD4) to facilitate DNA double-strand break repair.
26296641 2015 Predicting Response to Histone Deacetylase Inhibitors Using High-Throughput Genomics.
26265695 2015 Depletion of the chromatin remodeler CHD4 sensitizes AML blasts to genotoxic agents and reduces tumor formation.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25737278 2015 Resistance to therapy in BRCA2 mutant cells due to loss of the nucleosome remodeling factor CHD4.
More...