Property Summary

NCBI Gene PubMed Count 37
Grant Count 59
R01 Count 25
Funding $7,011,193.08
PubMed Score 207.43
PubTator Score 28.00

Knowledge Summary

Patent (15,844)

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 0.009

Synonym

Accession Q14833 B3KVL9 B7Z1T9 B7Z1U6 F5GXM5 Q5SZ84 Q6ZMQ2 mGluR4
Symbols mGlu4
GPRC1D
MGLUR4

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (22)

PMID Text
25613138 The gene expression of GRM4 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25342125 explored the relationship between the binding pockets of mGlu4-positive allosteric modulators with different chemical scaffolds and their functional properties
24984297 The GRM4 gene polymorphism was associated with the susceptibility and metastasis of osteosarcoma in a Chinese Han population.
24925192 The major depression subjects exhibited significantly higher expression level in the metabotropic receptor genes GRM4 in Locus coeruleus neurons.
24840839 study found that only one of the five SNPs tested showed a moderate but statistically significant association with juvenile myoclonic epilepsy in an Indian population
20859245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20826542 Data show that mGlu2 and mGlu4 subunits (but not mGlu2 and mGlu1) can heteromerize.
20338729 GRM4 sequence variants might confer low-risk effects to the etiology of idiopathic generalized epilepsies.
20338729 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGEL      1 - 70
KKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGG     71 - 140
PPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMV    141 - 210
DIVRALKWNYVSTVASEGSYGESGVEAFIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARA    211 - 280
VIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSS    281 - 350
RTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL    351 - 420
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQYQLRNDSAEYK    421 - 490
VIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCWHCEPCTGYQYQVDRYTCKTC    491 - 560
PYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIAATLFVVITFVRYNDTPIVKASGRELSYVLL    561 - 630
AGIFLCYATTFLMIAEPDLGTCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQL    631 - 700
AITFSLISLQLLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVY    701 - 770
AIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP    771 - 840
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALATKQTYVTYTNH    841 - 910
AI                                                                        911 - 912
//

Text Mined References (37)

PMID Year Title
25342125 2015 Overlapping binding sites drive allosteric agonism and positive cooperativity in type 4 metabotropic glutamate receptors.
24984297 2014 GRM4 gene polymorphism is associated with susceptibility and prognosis of osteosarcoma in a Chinese Han population.
24925192 2014 Elevated gene expression of glutamate receptors in noradrenergic neurons from the locus coeruleus in major depression.
24840839 2014 Association of the GRM4 gene variants with juvenile myoclonic epilepsy in an Indian population.
23727862 2013 Genome-wide association study identifies two susceptibility loci for osteosarcoma.
20859245 2011 Glutamatergic gene variants impact the clinical profile of efficacy and side effects of haloperidol.
20826542 2011 A new approach to analyze cell surface protein complexes reveals specific heterodimeric metabotropic glutamate receptors.
20338729 2010 Role of GRM4 in idiopathic generalized epilepsies analysed by genetic association and sequence analysis.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19351574 2009 Association study of polymorphisms in the group III metabotropic glutamate receptor genes, GRM4 and GRM7, with schizophrenia.
More...