Property Summary

NCBI Gene PubMed Count 82
Grant Count 91
R01 Count 49
Funding $15,800,623.56
PubMed Score 176.99
PubTator Score 82.28

Knowledge Summary

Patent (13,501)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.500 0.006
ependymoma -4.100 0.004
oligodendroglioma -2.500 0.000
glioblastoma -3.900 0.000
osteosarcoma -1.383 0.000
medulloblastoma -4.600 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -5.100 0.000
primitive neuroectodermal tumor -2.500 0.008
adult high grade glioma -4.200 0.000
pilocytic astrocytoma -4.200 0.000
subependymal giant cell astrocytoma -3.280 0.008
lung carcinoma 1.500 0.000
ovarian cancer -1.400 0.000
psoriasis -1.600 0.000

Synonym

Accession Q14832 Q2PNZ6 Q75MV4 Q75N17 Q86YG6 Q8TBH9 mGluR3
Symbols GLUR3
mGlu3
GPRC1C
MGLUR3

Gene

PANTHER Protein Class (2)

PDB

1S8M   3SM9   4XAR   5CNK   5CNM  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
602451 summary 0 / 0 / 0 Optimization of novel mGluR3-selective allosteric modulators
651830 other 1 / 0 / 0 ML337 mGlu3 NAM Competition in Radioligand Binding assays (Eurofins PanLabs)

Gene RIF (79)

PMID Text
26187343 Significant association was found between rs12704290 in GRM3 gene and schizophrenia(SCZ). A three-SNP LD spanning GRM3Delta4 splice site was significantly associated with SCZ. Interaction between the LD block and cognitive function was found in SCZ patients.
26071318 Grm3 expression was decreased in B cells from patients with autoimmune diseases such as activated systemic lupus erythematosus and multiple sclerosis.
25914064 Results show that GRM3 rs274622 C carriers with schizophrenia were associated with significantly smaller prefrontal activation than patients with TT genotype
25613138 The gene expression of GRM3 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25209194 PI4KA and GRM3 polymorphisms have potential to jointly modulate antipsychotic response
25198581 The mGluR3 promoted the proliferation of human embryonic cortical NPCs and increased cyclin D1 expression by activating ERK1/2 and JNK2 signaling pathways.
25150943 Results demonstrate no changes in expression and density of both 5-HT2AR and mGlu2/3R in the postmortem prefrontal cortex of subjects with major depressive disorder under basal conditions; antidepressant treatment induces a decrease in 5-HT2AR density
25096017 Pharmacogenetic relationships were identified in patients with schizophrenia between GRM3 variants and symptom response to antipsychotics.
24949866 Findings suggest that mGluR2/3 and mGluR5s are unaltered in the anterior cingulate cortex in psychotic and nonpsychotic depression, bipolar disorder and schizophrenia
24682224 The data of this study suggest an association of the GRM3 rs6465084 polymorphism with changes in pursuit maintenance after antipsychotic treatment.
More...

AA Sequence

MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLE      1 - 70
AMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPL     71 - 140
LIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNW    141 - 210
TYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDD    211 - 280
SRELIAAASRANASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPW    281 - 350
FRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD    351 - 420
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSYLKVGHWAETL    421 - 490
SLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLADEFTCMDCGSGQWPTADLT    491 - 560
GCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTF    561 - 630
FFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQI    631 - 700
VMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKF    701 - 770
IGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH    771 - 840
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL                                   841 - 879
//

Text Mined References (82)

PMID Year Title
26187343 2015 Evaluation of relationship between GRM3 polymorphisms and cognitive function in schizophrenia of Han Chinese.
26071318 2015 Ligation of metabotropic glutamate receptor 3 (Grm3) ameliorates lupus-like disease by reducing B cells.
25914064 2015 Effect of metabotropic glutamate receptor-3 variants on prefrontal brain activity in schizophrenia: An imaging genetics study using multi-channel near-infrared spectroscopy.
25209194 2014 Synergistic association of PI4KA and GRM3 genetic polymorphisms with poor antipsychotic response in south Indian schizophrenia patients with low severity of illness.
25198581 2014 mGluR3 promotes proliferation of human embryonic cortical neural progenitor cells by activating ERK1/2 and JNK2 signaling pathway in vitro.
25150943 2014 Evaluation of 5-HT2A and mGlu2/3 receptors in postmortem prefrontal cortex of subjects with major depressive disorder: effect of antidepressant treatment.
25096017 2015 Pharmacogenetic associations of the type-3 metabotropic glutamate receptor (GRM3) gene with working memory and clinical symptom response to antipsychotics in first-episode schizophrenia.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24949866 2014 Metabotropic glutamate receptor mGluR2/3 and mGluR5 binding in the anterior cingulate cortex in psychotic and nonpsychotic depression, bipolar disorder and schizophrenia: implications for novel mGluR-based therapeutics.
24682224 2014 Association of variants in DRD2 and GRM3 with motor and cognitive function in first-episode psychosis.
More...