Property Summary

Ligand Count 30
NCBI Gene PubMed Count 84
PubMed Score 186.87
PubTator Score 82.28

Knowledge Summary

Patent (13,501)


  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -4.200 9.9e-08
astrocytic glioma -3.500 6.3e-03
Astrocytoma, Pilocytic -4.200 1.2e-13
atypical teratoid / rhabdoid tumor -3.200 4.5e-05
ependymoma -4.100 4.0e-03
glioblastoma -3.400 1.2e-09
group 3 medulloblastoma -3.700 4.9e-07
lung carcinoma 1.500 1.5e-12
medulloblastoma, large-cell -5.100 4.3e-08
oligodendroglioma -2.200 2.8e-02
osteosarcoma -1.383 4.3e-05
ovarian cancer -1.400 7.3e-08
primitive neuroectodermal tumor -2.500 8.1e-03
psoriasis -1.600 9.3e-11
subependymal giant cell astrocytoma -3.280 8.3e-03

Gene RIF (81)

AA Sequence

LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL                                   841 - 879

Text Mined References (84)

PMID Year Title