Property Summary

NCBI Gene PubMed Count 55
PubMed Score 190.84
PubTator Score 46.27

Knowledge Summary

Patent (9,356)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.600 1.5e-05
astrocytic glioma -2.200 2.3e-03
atypical teratoid / rhabdoid tumor -3.100 1.5e-10
ependymoma -2.400 3.5e-03
glioblastoma -2.600 1.7e-09
group 3 medulloblastoma -2.800 2.4e-04
medulloblastoma, large-cell -2.500 2.0e-04
oligodendroglioma -2.100 5.5e-03
primitive neuroectodermal tumor -1.600 2.4e-02

Gene RIF (43)

AA Sequence

MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDI      1 - 70
KRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGE     71 - 140
PPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMV    141 - 210
DIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNS    211 - 280
RAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYF    281 - 350
TSRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH    351 - 420
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNP    421 - 490
GYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTC    491 - 560
QHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSY    561 - 630
VLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPT    631 - 700
SQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTC    701 - 770
TVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML    771 - 840
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNSPAAKKKYVSY    841 - 910
NNLVI                                                                     911 - 915
//

Text Mined References (55)

PMID Year Title