Property Summary

NCBI Gene PubMed Count 53
Grant Count 48
R01 Count 18
Funding $10,669,918.6
PubMed Score 186.65
PubTator Score 46.27

Knowledge Summary

Patent (9,356)

Expression

  Differential Expression (9)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
743384 confirmatory 20 / 0 / 3 Potency at mGlu7 using calcium mobilization
743385 confirmatory 1 / 0 / 0 Fold shift mGlu7 using calcium mobilization
743386 confirmatory 1 / 0 / 0 Fold shift mGlu7 using GIRK Assay

Gene RIF (41)

PMID Text
26905411 Glutamate system genes have been associated with disease risk in recent analyses from the Psychiatric Genomics Consortium.
26866891 Multiple genetic models identified 1 significant locus, GRM7, for 2 hypertension-derived traits.
26655190 Study represents a genetic association test towards single variant and multi-markers interaction of GRM7 and GRM8 genes in both schizophrenia and major depressive disorders in Han Chinese population
26254163 results indicate that the GRM7 SNPs rs13353402 and rs1531939 might be associated with schizophrenia in Chinese Han population.
25613138 The gene expression of GRM7 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25360607 results reported here do not support a role for GRM7 in ADHD
24804643 Copy number variants at GRM7 may have a role in the etiology of bipolar disorder.
24278217 For neither PCLO nor GRM7 we found a more associated variant. For SLC6A4, we found a new SNP that showed a lower P-value than in the GAIN-MDD GWAS
24146964 in an elderly male Han Chinese population, GRM7 SNP rs11928865 (TT) occurs more frequently in age-related hearing impairment patients with SL and AL phenotype patterns.
23295062 These results provide preliminary evidence of an association between the GRM7 rs37952452 polymorphism and selective attention deficit and anxiety found within the Korean ADHD population
More...

AA Sequence

MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDI      1 - 70
KRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGE     71 - 140
PPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMV    141 - 210
DIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNS    211 - 280
RAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYF    281 - 350
TSRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH    351 - 420
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNP    421 - 490
GYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTC    491 - 560
QHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSY    561 - 630
VLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPT    631 - 700
SQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTC    701 - 770
TVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML    771 - 840
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNSPAAKKKYVSY    841 - 910
NNLVI                                                                     911 - 915
//

Text Mined References (53)

PMID Year Title
26905411 2016 Antipsychotic pharmacogenomics in first episode psychosis: a role for glutamate genes.
26866891 2016 Longitudinal analytical approaches to genetic data.
26655190 2016 Significant association of GRM7 and GRM8 genes with schizophrenia and major depressive disorder in the Han Chinese population.
26254163 2015 Association study of GRM7 polymorphisms and schizophrenia in the Chinese Han population.
25360607 2014 Lack of association between the GRM7 gene and attention deficit hyperactivity disorder.
24804643 2014 Allelic association, DNA resequencing and copy number variation at the metabotropic glutamate receptor GRM7 gene locus in bipolar disorder.
24278217 2013 Resequencing three candidate genes for major depressive disorder in a Dutch cohort.
24146964 2013 Association of GRM7 variants with different phenotype patterns of age-related hearing impairment in an elderly male Han Chinese population.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23468962 2013 A genome-wide scan for breast cancer risk haplotypes among African American women.
More...