Property Summary

NCBI Gene PubMed Count 56
Grant Count 25
R01 Count 22
Funding $2,808,969.7
PubMed Score 79.11
PubTator Score 41.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.200 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
sonic hedgehog group medulloblastoma -1.200 0.000
medulloblastoma, large-cell 1.100 0.002
primitive neuroectodermal tumor -1.300 0.000
adult high grade glioma -1.600 0.000
ovarian cancer -1.200 0.000

Protein-protein Interaction (1)

Gene RIF (26)

PMID Text
26355845 miR-1244 and MEF2D form an autoregulatory loop contributing to the progression of lung carcinoma.
26164003 MEF2D was also found to increase the transcription of Pokemon by binding myocyte enhancer factor 2 (MEF2) sites within its promoter region, that can promote Hepatocellular carcinoma invasion
25814384 MEF2D suppression was shown to decrease the proliferation of osteosarcoma cells.
25812649 Cell cycle progression was also inhibited by MEF2D suppression.
25733682 MEF2C and MEF2D interact with the E3 ligase F-box protein SKP2, which mediates their subsequent degradation through the ubiquitin-proteasome system.
25472877 OA induced cell cycle arrest in lung cancer cells through miR-122/Cyclin G1/MEF2D pathway. This finding may contribute to the understanding of the molecular mechanism of OA's anti-tumor activity
24390737 MEF2D-silencing abolished hepatocellular carcinoma tumorigenicity.
24279793 The oncogenic properties of rhabdomyosarcoma cells can be partially attributed to the loss of MEF2D expression.
24219011 Oxidation of survival factor MEF2D inhibits its function, underlies oxidative stress-induced neurotoxicity, and may be a part of the Parkinson disease pathogenic process.
22256741 The expression of MEF2D was higher in the higher clinical stage of nasopharyngeal carcinoma, but there was no correlation with survival rate.
More...

AA Sequence

MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYT      1 - 70
EYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNF     71 - 140
AMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDL    141 - 210
NSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKG    211 - 280
LMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAF    281 - 350
SSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP    351 - 420
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDF    421 - 490
GPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK                                           491 - 521
//

Publication (69)

PMID Year Title
26355845 2015 miR-1244/Myocyte Enhancer Factor 2D Regulatory Loop Contributes to the Growth of Lung Carcinoma.
26164003 2015 Pokemon and MEF2D co-operationally promote invasion of hepatocellular carcinoma.
25814384 2015 MEF2D overexpression contributes to the progression of osteosarcoma.
25812649 2015 miR-218 suppresses cardiac myxoma proliferation by targeting myocyte enhancer factor 2D.
25733682 2015 The control operated by the cell cycle machinery on MEF2 stability contributes to the downregulation of CDKN1A and entry into S phase.
25472877 2015 Oleanolic acid suppresses the proliferation of lung carcinoma cells by miR-122/Cyclin G1/MEF2D axis.
24390737 2014 Overexpression of the transcription factor MEF2D in hepatocellular carcinoma sustains malignant character by suppressing G2-M transition genes.
24279793 2013 Loss of MEF2D expression inhibits differentiation and contributes to oncogenesis in rhabdomyosarcoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24219011 2014 Oxidation of survival factor MEF2D in neuronal death and Parkinson's disease.
More...