Property Summary

NCBI Gene PubMed Count 32
PubMed Score 54.31
PubTator Score 73.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -2.592 0.000
sonic hedgehog group medulloblastoma 1.500 0.000
juvenile dermatomyositis -1.008 0.000
lung cancer 1.100 0.011
adult high grade glioma -1.400 0.000
non primary Sjogren syndrome sicca 1.200 0.013
pituitary cancer 1.300 0.000

Synonym

Accession Q14807 B2R5M0 B7Z265 O60845 O94814 Q53F58 Q9BT46
Symbols KID
OBP
KNSL4
OBP-1
OBP-2
SEMDJL2
A-328A3.2

Gene

PDB

2EDU   3BFN  

Gene RIF (12)

PMID Text
25743205 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
24626146 we conclude that inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through the transcriptional upregulation of CDC25C.
22152678 Recurrent dominant mutations affecting two adjacent residues in the motor domain of the monomeric kinesin KIF22 result in skeletal dysplasia and joint laxity
22152677 Whole-exome sequencing identifies mutations of KIF22 in spondyloepimetaphyseal dysplasia with joint laxity, leptodactylic type
20144232 in all breast tumor tissues analyzed, variations in the Kid/KIF22 mRNA levels mirrored those seen with SIAH-1 mRNAs.
18329364 These data suggest that Kid-mediated anaphase/telophase chromosome compaction prevents formation of multinucleated cells.
18268099 Association of importin-beta and -alpha with hKid triggers the initial targeting of hKid to mitotic chromosomes; local Ran-GTP-mediated cargo release promotes the accumulation of hKid on chromosomes.
17726374 human Aurora B and Kid are identified as APC/C(Cdh1) substrates
16176979 These results suggest that distinct from its role in chromosome movement, Kid contributes to spindle morphogenesis by mediating spindle microtubules stabilization.
12805422 KID is hypothesized to be a human breast cancer variant of Rev/Rex effector binding protein (REBP), a nuclear protein that binds HIV-1 Rev, co-localizes with Rev in the nucleoplasm and nuclear periphery of cells, and enhances Rev-dependent mRNA expression
More...

AA Sequence

MAAGGSTQQRRREMAAASAAAISGAGRCRLSKIGATRRPPPARVRVAVRLRPFVDGTAGASDPPCVRGMD      1 - 70
SCSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGS     71 - 140
PEQPGVIPRALMDLLQLTREEGAEGRPWALSVTMSYLEIYQEKVLDLLDPASGDLVIREDCRGNILIPGL    141 - 210
SQKPISSFADFERHFLPASRNRTVGATRLNQRSSRSHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSED    211 - 280
NRRTGNKGLRLKESGAINTSLFVLGKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERR    281 - 350
FYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARGPEEEEIGSPEPMAAPA    351 - 420
SASQKLSPLQKLSSMDPAMLERLLSLDRLLASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQK    421 - 490
ELEAKMLAQKAEEKENHCPTMLRPLSHRTVTGAKPLKKAVVMPLQLIQEQAASPNAEIHILKNKGRKRKL    491 - 560
ESLDALEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQ    561 - 630
VEDLERVEGITGKQMESFLKANILGLAAGQRCGAS                                       631 - 665
//

Publication (40)

PMID Year Title
25743205 2015 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
24626146 2014 Inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through upregulating CDC25C expression.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22152678 2011 Recurrent dominant mutations affecting two adjacent residues in the motor domain of the monomeric kinesin KIF22 result in skeletal dysplasia and joint laxity.
22152677 2011 Whole-exome sequencing identifies mutations of KIF22 in spondyloepimetaphyseal dysplasia with joint laxity, leptodactylic type.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20144232 2010 Distinct expression patterns of the E3 ligase SIAH-1 and its partner Kid/KIF22 in normal tissues and in the breast tumoral processes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...