Property Summary

NCBI Gene PubMed Count 9
PubMed Score 22.81
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.185 1.6e-08
ovarian cancer -1.500 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.700 1.1e-02
tuberculosis and treatment for 3 months -1.300 6.1e-04

Synonym

Accession Q147X3 Q0IIN2
Symbols MAK3
Mak3p
NAT12
NAT12P
C14orf35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAEVPPGPSSLLPPPAPPAPAAVEPRCPFPAGAALACCSEDEEDDEEHEGGGSRSPAGGESATVAAKGHP      1 - 70
CLRCPQPPQEQQQLNGLISPELRHLRAAASLKSKVLSVAEVAATTATPDGGPRATATKGAGVHSGERPPH     71 - 140
SLSSNARTAVPSPVEAAAASDPAAARNGLAEGTEQEEEEEDEQVRLLSSSLTADCSLRSPSGREVEPGED    141 - 210
RTIRYVRYESELQMPDIMRLITKDLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFR    211 - 280
RGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLN    281 - 350
GVDALRLKLWLR                                                              351 - 362
//

Text Mined References (16)

PMID Year Title