Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 4
Funding $414,722.4
PubMed Score 21.71
PubTator Score 4.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.185 0.000
pancreatic ductal adenocarcinoma liver m... -1.700 0.011
tuberculosis and treatment for 3 months -1.300 0.001
ovarian cancer -1.500 0.000

Synonym

Accession Q147X3 Q0IIN2
Symbols MAK3
Mak3p
NAT12
NAT12P
C14orf35

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
26292663 NAT12/NAA30 plays an important role in growth and survival of GICs possibly by regulating hypoxia response (HIF1a), levels of p-MTOR (Ser2448) and the p53 pathway.
19398576 Human Naa30 (MAK3) is the catalytic subunit of the human NatC N-terminal acetyltransferase complex. NatC acetylates hydrophobic Met-starting N-termini, and NatC knockdown induces p53-dependent apoptosis.

AA Sequence

MAEVPPGPSSLLPPPAPPAPAAVEPRCPFPAGAALACCSEDEEDDEEHEGGGSRSPAGGESATVAAKGHP      1 - 70
CLRCPQPPQEQQQLNGLISPELRHLRAAASLKSKVLSVAEVAATTATPDGGPRATATKGAGVHSGERPPH     71 - 140
SLSSNARTAVPSPVEAAAASDPAAARNGLAEGTEQEEEEEDEQVRLLSSSLTADCSLRSPSGREVEPGED    141 - 210
RTIRYVRYESELQMPDIMRLITKDLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFR    211 - 280
RGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLN    281 - 350
GVDALRLKLWLR                                                              351 - 362
//

Text Mined References (12)

PMID Year Title
26292663 2015 Knockdown of NAT12/NAA30 reduces tumorigenic features of glioblastoma-initiating cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19398576 2009 Knockdown of human N alpha-terminal acetyltransferase complex C leads to p53-dependent apoptosis and aberrant human Arl8b localization.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...