Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 6.12316891431442E-10
group 4 medulloblastoma 1875 6.57800534954616E-5
glioblastoma 5572 9.26078910591015E-5
atypical teratoid / rhabdoid tumor 4369 2.03387873710002E-4
adult high grade glioma 2148 3.24095624876324E-4
medulloblastoma, large-cell 6234 3.53696730560392E-4
primitive neuroectodermal tumor 3031 0.00454015243568228
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00836786776478057
spina bifida 1064 0.035817889435841

Expression

  Differential Expression (9)

Synonym

Accession Q147U1 A8K0H1 B3KUP1
Symbols

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Horse OMA EggNOG

AA Sequence

MDSSQHLVTFEDVAVDFTQEEWTLLDQAQRDLYRDVMLENYKNLIILAGSELFKRSLMSGLEQMEELRTG      1 - 70
VTGVLQELDLQLKTKGSPLLQDISAERSPNGVQLERSNTAEKLYDSNHSGKVFNEHPFLMTHMITHIGEK     71 - 140
TSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAFNQFPNLTRQNKTHTQEKLCECKDCWRTFLNQ    141 - 210
SSLKLHIRSHNGDKHYVCKECGKAFSNSSHLIGHGRIHSGEKPYVCKECGKAFTQSTGLKLHIRTHSGEK    211 - 280
PYKCKECGKAFTHSSYLTDHTRIHSGKKPYVCMECGKAFTRSTGLILHMRIHTGEKPYECKECGKAFIHS    281 - 350
SYLTKHVRIHSGEKLYLCKACGKAFTRSSGLVLHMRTHTGEKPYECKECGKAFNNSSMLSQHVRIHTGEK    351 - 420
PYECKECGKAFTQSSGLSTHLRTHTGEKACECKECGKAFARSTNLNMHMRTHTGEKPYACKECGKAFRYS    421 - 490
TYLNVHTRTHTGAKPYECKKCGKNFTQSSALAKHLRTKACEKT                               491 - 533
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.