Property Summary

Ligand Count 117
NCBI Gene PubMed Count 700
PubMed Score 3121.41
PubTator Score 2090.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 5.0

Expression

  Differential Expression (15)

Disease log2 FC p
lung cancer -1.800 7.7e-04
adult high grade glioma 2.400 4.7e-07
Astrocytoma, Pilocytic 2.000 1.7e-09
atypical teratoid / rhabdoid tumor 1.400 8.1e-03
breast carcinoma 1.200 1.8e-02
cutaneous lupus erythematosus 1.800 4.3e-03
ependymoma 1.100 2.7e-11
glioblastoma 2.200 6.7e-08
intraductal papillary-mucinous neoplasm ... 1.600 7.4e-04
lung carcinoma -2.200 1.5e-31
osteosarcoma -1.124 3.4e-05
ovarian cancer 1.100 4.1e-03
primary Sjogren syndrome 1.100 1.3e-02
psoriasis 2.100 4.5e-05
subependymal giant cell astrocytoma 2.322 2.4e-02

Protein-protein Interaction (1)

Gene RIF (596)

AA Sequence

MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRIN      1 - 70
RLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLL     71 - 140
DIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISD    141 - 210
SPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFE    211 - 280
IKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAG    281 - 350
KPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW    351 - 420
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD               421 - 479
//

Text Mined References (704)

PMID Year Title