Property Summary

NCBI Gene PubMed Count 648
Grant Count 964
R01 Count 659
Funding $92,140,396.88
PubMed Score 2954.74
PubTator Score 2090.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Gene

PDB

1F9E   1I4E   1QDU   1QTN   2C2Z   2FUN   2K7Z   2Y1L   3H11   3KJN   3KJQ   4JJ7   4PRZ   4PS1   4ZBW  

Gene RIF (557)

PMID Text
26990987 procaspase-8:c-FLIPL exhibits localized enzymatic activity and is preferentially an activator, promoting DED-mediated procaspase-8 oligomer assembly, whereas procaspase-8:c-FLIPS lacks activity and potently blocks procaspase-8 activation
26758508 we conclude that some SNPs in CASP8 are associated with subtype-specific breast cancer risk. This study contributes to our understanding of CASP8 SNPs and breast cancer risk by subtype.
26690594 Frequencies of SNPs rs2234978 and rs1045487 of FAS and CASP8 genes were significantly higher in Autoimmune Lymphoproliferative Syndrome patients.
26563540 Excessive TLR9 signaling contributed to maternal-fetal tolerance disruption via an effect on Treg cell survival by activation of Caspase 8/3
26510914 Data show that when death receptor 5 (DR5) is suppressed, caspase-8 may recruit and stabilize TNF receptor-associated factor 2 (TRAF2) to form a metastasis and invasion signaling complex, resulting in activation of ERK signaling.
26468282 ASC induces procaspase-8 death effector domain filaments
26466953 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26437781 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26370846 procaspase-8 death effector domain chain that is crucial for its activation and subsequent cell death
26107208 A frame-shift and a novel missense mutation in CASP8 gene is associated with oral Squamous Cell Carcinoma.
More...

AA Sequence

MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRIN      1 - 70
RLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLL     71 - 140
DIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISD    141 - 210
SPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFE    211 - 280
IKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAG    281 - 350
KPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW    351 - 420
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD               421 - 479
//

Text Mined References (652)

PMID Year Title
26990987 2016 Co-operative and Hierarchical Binding of c-FLIP and Caspase-8: A Unified Model Defines How c-FLIP Isoforms Differentially Control Cell Fate.
26758508 2016 Novel polymorphisms in caspase-8 are associated with breast cancer risk in the California Teachers Study.
26690594 Polymorphisms in FAS and CASP8 genes may contribute to the development of ALPS phenotype: a study in 25 patients with probable ALPS.
26563540 2015 Excessive TLR9 signaling contributes to the pathogenesis of spontaneous abortion through impairment of Treg cell survival by activation of Caspase 8/3.
26510914 2015 Suppression of death receptor 5 enhances cancer cell invasion and metastasis through activation of caspase-8/TRAF2-mediated signaling.
26468282 2015 The Inflammasome Adaptor ASC Induces Procaspase-8 Death Effector Domain Filaments.
26466953 2015 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26437781 2016 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26370846 2016 Molecular basis of death effector domain chain assembly and its role in caspase-8 activation.
26107208 2015 Mutation Analysis of the Dimer Forming Domain of the Caspase 8 Gene in Oral Submucous Fibrosis and Squamous Cell Carcinomas.
More...