Property Summary

NCBI Gene PubMed Count 648
PubMed Score 2954.74
PubTator Score 2090.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 1.49020528468679E-31
posterior fossa group B ependymoma 1530 4.50848596540891E-17
pilocytic astrocytoma 3086 1.47933751836148E-9
adult high grade glioma 2148 4.74785809047407E-7
psoriasis 6685 4.54495109710052E-5
osteosarcoma 7933 4.65788153963867E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.394182989801E-4
glioblastoma 5572 8.33550110957663E-4
ovarian cancer 8492 0.00408380617230655
cutaneous lupus erythematosus 1056 0.0043006010354573
atypical teratoid / rhabdoid tumor 4369 0.00808901697332092
primary Sjogren syndrome 789 0.0131196447007154
breast carcinoma 1614 0.0179347412444852
subependymal giant cell astrocytoma 2287 0.0242001224836042
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Autoimmune Lymphoproliferative Syndrome 12 3.977 2.0
Breast cancer 3099 0.0 5.0

Expression

  Differential Expression (15)

Synonym

Gene

PDB

1F9E   1I4E   1QDU   1QTN   2C2Z   2FUN   2K7Z   2Y1L   3H11   3KJN   3KJQ   4JJ7   4PRZ   4PS1   4ZBW  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (551)

PMID Text
26990987 procaspase-8:c-FLIPL exhibits localized enzymatic activity and is preferentially an activator, promoting DED-mediated procaspase-8 oligomer assembly, whereas procaspase-8:c-FLIPS lacks activity and potently blocks procaspase-8 activation
26758508 we conclude that some SNPs in CASP8 are associated with subtype-specific breast cancer risk. This study contributes to our understanding of CASP8 SNPs and breast cancer risk by subtype.
26690594 Frequencies of SNPs rs2234978 and rs1045487 of FAS and CASP8 genes were significantly higher in Autoimmune Lymphoproliferative Syndrome patients.
26563540 Excessive TLR9 signaling contributed to maternal-fetal tolerance disruption via an effect on Treg cell survival by activation of Caspase 8/3
26510914 Data show that when death receptor 5 (DR5) is suppressed, caspase-8 may recruit and stabilize TNF receptor-associated factor 2 (TRAF2) to form a metastasis and invasion signaling complex, resulting in activation of ERK signaling.
26468282 ASC induces procaspase-8 death effector domain filaments
26466953 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26437781 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26370846 procaspase-8 death effector domain chain that is crucial for its activation and subsequent cell death
26107208 A frame-shift and a novel missense mutation in CASP8 gene is associated with oral Squamous Cell Carcinoma.
More...

AA Sequence

MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRIN      1 - 70
RLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLL     71 - 140
DIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISD    141 - 210
SPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFE    211 - 280
IKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAG    281 - 350
KPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW    351 - 420
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD               421 - 479
//

Text Mined References (652)

PMID Year Title
26990987 2016 Co-operative and Hierarchical Binding of c-FLIP and Caspase-8: A Unified Model Defines How c-FLIP Isoforms Differentially Control Cell Fate.
26758508 2016 Novel polymorphisms in caspase-8 are associated with breast cancer risk in the California Teachers Study.
26690594 Polymorphisms in FAS and CASP8 genes may contribute to the development of ALPS phenotype: a study in 25 patients with probable ALPS.
26563540 2015 Excessive TLR9 signaling contributes to the pathogenesis of spontaneous abortion through impairment of Treg cell survival by activation of Caspase 8/3.
26510914 2015 Suppression of death receptor 5 enhances cancer cell invasion and metastasis through activation of caspase-8/TRAF2-mediated signaling.
26468282 2015 The Inflammasome Adaptor ASC Induces Procaspase-8 Death Effector Domain Filaments.
26466953 2015 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26437781 2016 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26370846 2016 Molecular basis of death effector domain chain assembly and its role in caspase-8 activation.
26107208 2015 Mutation Analysis of the Dimer Forming Domain of the Caspase 8 Gene in Oral Submucous Fibrosis and Squamous Cell Carcinomas.
More...