Property Summary

Ligand Count 1
NCBI Gene PubMed Count 26
PubMed Score 24.34
PubTator Score 38.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.600 2.6e-04
atypical teratoid / rhabdoid tumor 3.200 7.6e-13
Breast cancer 2.000 1.3e-06
ductal carcinoma in situ 1.200 1.6e-03
ependymoma 1.900 1.9e-11
glioblastoma 1.800 3.5e-06
group 3 medulloblastoma 3.100 8.7e-07
invasive ductal carcinoma 2.300 1.4e-02
medulloblastoma, large-cell 3.600 2.1e-08
non-small cell lung cancer 1.768 7.1e-13
ovarian cancer 1.900 3.8e-08
primitive neuroectodermal tumor 3.900 1.2e-07
psoriasis 1.100 5.2e-43

Gene RIF (10)

AA Sequence

MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNR      1 - 70
KRGKRPRGRPRKLTAMSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEDDSDLDAKRGPRGRETH     71 - 140
PVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKATRRPVSLAKVLKTARKDLGAPASKLPPPLSAPVAG    141 - 210
LAALKAHAKEACGGPSAMATPENLASLMKGMASSPGRGGISWQSSIVHYMNRMTQSQAQAASRLALKAQA    211 - 280
TNKCGLGLDLKVRTQKGELGMSPPGSKIPKAPSGGAVEQKVGNTGGPPHTHGASRVPAGCPGPQPAPTQE    281 - 350
LSLQVLDLQSVKNGMPGVGLLARHATATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLASRAVA    351 - 420
PPTPASKRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTS    421 - 490
QDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY                                491 - 532
//

Text Mined References (32)

PMID Year Title