Property Summary

NCBI Gene PubMed Count 36
Grant Count 23
R01 Count 13
Funding $1,929,467.36
PubMed Score 70.23
PubTator Score 50.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (19)

PMID Text
23888188 Studies have identified HLX as a novel key transcription factor involved in the regulation of early hematopoiesis and AML pathogenesis.
23243425 The expression levels of Hlx, T-bet, and IFN-gamma were significantly decreased.
22989111 Data suggest that HLX1 is downstream mediator of hepatocyte growth factor- (HGF-) induced cell survival, cell proliferation, and invasive properties of trophoblast cells; thus, both HGF and HLX1 appear to be involved in normal placental development.
22897850 This study identifies HLX as a key regulator in immature hematopoietic and leukemia cells and as a prognostic marker and therapeutic target in acute myeloid leukemia.
22303482 This study investigated the influence of TBX21 and HLX1 single nucleotide polymorphisms (SNPs), which have previously been shown to be associated with asthma, on T(H)1/T(H)2 lineage cytokines at birth.
22014209 a functional polymorphism in HLX in combination with the TBX21 polymorphism is also associated with the prognosis of Graves' disease.
21224470 These data suggest that HLX may function to balance attractive with repulsive vessel guidance by up-regulating UNC5B and to down-modulate sprouting under normoxic conditions.
20554918 HLX is a mediator of HGF/c-met-dependent trophoblast migration but is not involved in the regulation of trophoblast invsion.
20008130 Cell cycle regulatory genes RB1, MYC, CCNB1, ELK1, JUN, and CDKN1C, which control important trophoblast cell functions, are targets of HLX.
19459883 Sequence variants in the HLX gene at chromosome 1q41-1q42 in patients with diaphragmatic hernia
More...

AA Sequence

MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAA      1 - 70
ALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPP     71 - 140
PPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAG    141 - 210
VHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSR    211 - 280
AVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEK    281 - 350
PSGGAPAADGEQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERSLHQTTVIKAPVTGALITASS    351 - 420
AGSGGSSGGGGNSFSFSSASSLSSSSTSAGCASSLGGGGASELLPATQPTASSAPKSPEPAQGALGCL      421 - 488
//

Text Mined References (39)

PMID Year Title
23888188 2012 HLX in AML: novel prognostic and therapeutic target.
23455154 2013 Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK?a regulation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23243425 2012 Downregulation of Hlx closely related to the decreased expressions of T-bet and Runx3 in patients with gastric cancer may be associated with a pathological event leading to the imbalance of Th1/Th2.
22989111 2012 Hepatocyte growth factor regulates HLX1 gene expression to modulate HTR-8/SVneo trophoblast cells.
22897850 2012 H2.0-like homeobox regulates early hematopoiesis and promotes acute myeloid leukemia.
22303482 2012 TBX21 and HLX1 polymorphisms influence cytokine secretion at birth.
22014209 2012 Functional polymorphisms in TBX21 and HLX are associated with development and prognosis of Graves' disease.
21224470 2011 The VEGF-regulated transcription factor HLX controls the expression of guidance cues and negatively regulates sprouting of endothelial cells.
20554918 2010 Homeobox gene HLX is a regulator of HGF/c-met-mediated migration of human trophoblast-derived cell lines.
More...