Property Summary

NCBI Gene PubMed Count 39
PubMed Score 73.22
PubTator Score 50.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
group 3 medulloblastoma 3.000 1.3e-04
interstitial cystitis 1.200 4.3e-03
intraductal papillary-mucinous adenoma (... -1.100 5.4e-04
intraductal papillary-mucinous carcinoma... -1.100 1.2e-03
lung adenocarcinoma -1.200 3.4e-10
malignant mesothelioma -2.700 3.8e-08
nephrosclerosis 1.925 1.6e-04
ovarian cancer -1.400 1.5e-08
pancreatic cancer 1.500 2.8e-03
pancreatic carcinoma 1.500 2.8e-03
psoriasis 1.400 1.1e-03
subependymal giant cell astrocytoma 1.128 2.1e-02

Gene RIF (22)

AA Sequence

MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAA      1 - 70
ALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPP     71 - 140
PPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAG    141 - 210
VHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSR    211 - 280
AVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEK    281 - 350
PSGGAPAADGEQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERSLHQTTVIKAPVTGALITASS    351 - 420
AGSGGSSGGGGNSFSFSSASSLSSSSTSAGCASSLGGGGASELLPATQPTASSAPKSPEPAQGALGCL      421 - 488
//

Text Mined References (42)

PMID Year Title