Property Summary

NCBI Gene PubMed Count 68
PubMed Score 18.23
PubTator Score 55.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Megalocornea 13 3.694 1.8

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.200 6.2e-05
Astrocytoma, Pilocytic 1.200 5.1e-04
atypical teratoid / rhabdoid tumor 1.300 3.6e-03
Breast cancer -2.000 4.2e-15
colon cancer 1.100 3.4e-02
cystic fibrosis 1.947 3.1e-07
gastric carcinoma 1.100 1.2e-02
glioblastoma 1.800 1.3e-02
intraductal papillary-mucinous adenoma (... -1.400 3.2e-03
intraductal papillary-mucinous carcinoma... -2.200 9.6e-04
intraductal papillary-mucinous neoplasm ... -2.300 4.2e-03
invasive ductal carcinoma 1.409 6.7e-04
lung adenocarcinoma -1.300 7.3e-08
lung cancer -1.200 3.5e-04
lung carcinoma -2.100 1.0e-16
medulloblastoma 1.200 8.3e-04
medulloblastoma, large-cell 1.100 1.3e-04
non-small cell lung cancer -1.279 2.0e-10
osteosarcoma -2.468 1.5e-03
ovarian cancer -1.700 2.8e-05
pancreatic cancer 2.400 6.7e-04
pancreatic ductal adenocarcinoma liver m... 1.079 1.3e-02
pterygium 1.300 3.6e-03
type II diabetes mellitus and post-ische... 1.400 3.2e-02

 IMPC Phenotype (1)

Gene RIF (45)

AA Sequence

MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSYPAAAAAKVYS      1 - 70
LFREQDAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVQPPAQTRRSTPLGQQQPAPRTRAAP     71 - 140
ALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTANSTNHCIKPVCEPPCQNRGSCSRPQLCVCR    141 - 210
SGFRGARCEEVIPDEEFDPQNSRLAPRRWAERSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPPAGTLS    211 - 280
GLSQTHPSQQHVGLSRTVRLHPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKK    281 - 350
IKIVFTPTICKQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPA    351 - 420
NSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVHIHHPPEASVQIHQ    421 - 490
VAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPLPPAAPRPRGLLGRCYLNTVN    491 - 560
GQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPVIENGQLECPQGYKRLNLTHCQDINECLTLG    561 - 630
LCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSR    631 - 700
VGKAWGSECEKCPLPGTEAFREICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAER    701 - 770
QPLRVVTDTWLEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTL    771 - 840
STPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKGRCINRVGSYS    841 - 910
CFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTC    911 - 980
PDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQ    981 - 1050
DVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDC   1051 - 1120
DGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHG   1121 - 1190
ECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDI   1191 - 1260
DECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLC   1261 - 1330
DQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAP   1331 - 1400
TGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYI   1401 - 1470
PVEGAWTFGQTMYTDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACENG   1471 - 1540
ECVNTEGSFHCFCSPPLTLDLSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECC   1541 - 1610
CQDGEAWSQQCALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYL   1611 - 1680
GPEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVR   1681 - 1750
VREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCTAK   1751 - 1820
E//

Text Mined References (67)

PMID Year Title