Property Summary

NCBI Gene PubMed Count 63
PubMed Score 15.56
PubTator Score 55.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.04703284165643E-16
non-small cell lung cancer 2798 1.958201744207E-10
lung adenocarcinoma 2714 7.30794432002967E-8
pilocytic astrocytoma 3086 5.33252253855079E-7
cystic fibrosis 1670 7.22820464791191E-7
Breast cancer 3099 7.73265502958859E-6
sonic hedgehog group medulloblastoma 1482 1.28168752152824E-5
lung cancer 4473 1.7014940138156E-5
atypical teratoid / rhabdoid tumor 4369 3.15437453773092E-5
ovarian cancer 8492 4.39252931966169E-5
medulloblastoma, large-cell 6234 1.25866103034047E-4
pancreatic cancer 2300 6.67600396491463E-4
invasive ductal carcinoma 2950 6.71495917612205E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.61131524266775E-4
osteosarcoma 7933 0.00151727391334838
primary pancreatic ductal adenocarcinoma 1271 0.00165501305938827
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00318721983132318
pterygium 74 0.00364649663329055
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0042446730178722
pediatric high grade glioma 2712 0.00489414355534443
gastric carcinoma 832 0.0119803264766776
glioblastoma 5572 0.0132574820957334
type II diabetes mellitus and post-ischemic heart failure 89 0.0322838475324089
colon cancer 1475 0.0341481659136781
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Megalocornea 15 3.602 1.8

Expression

Synonym

Accession Q14767 Q99907 Q9NS51 LTBP-2
Symbols WMS3
GLC3D
LTBP3
MSPKA
MSTP031
C14orf141

Gene

  Ortholog (10)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (42)

PMID Text
27293371 The results showed that no deleterious mutations were found in coding regions of LTBP2 in patients with PCG, suggesting that it is not a causal gene for primary congenital glaucoma in the Han Chinese population.
26644005 LTBP-2 and FGF-2 are co-localized in fibrotic human keloid and hypertrophic scar.
26263555 LTBP-2 is a potent inhibitor of FGF-2 that may influence FGF-2 bioactivity during wound repair particularly in fibrotic tissues.
25974126 LTBP2 was able to reduce phosphorylation of p65 at Serine 536, inhibit nuclear localization of active phosphorylated p65, and impair the p65 DNA-binding ability. This results in a consequential down-regulation of p65-related gene expression.
24908666 LTBP-2 is an essential component for the formation of microfibril bundles in ciliary zonules.
24867584 perlecan HS was not essential for latent transforming growth factor-beta-1 binding protein-2 deposition
24803312 Increased plasma levels of LTBP2 and/or OPN are present in plasma up to 2 years prior to diagnosis of hepatocellular carcinoma.
24148803 Overall the results indicate that LTBP-2 may have a negative regulatory role during elastic fiber assembly, perhaps in displacing elastin microassemblies from complexes with fibulin-5 and/or cell surface heparan sulfate proteoglycans.
23401661 Some LTBP2 sequence variations can contribute to the etiology of primary open angle glaucoma (POAG) and pseudoexfoliation (PEX) glaucoma syndrome.
23378721 No pathogenic variants are identified in the LTBP2 gene in a cohort of patients with primary congenital glaucoma.
More...

AA Sequence

MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSYPAAAAAKVYS      1 - 70
LFREQDAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVQPPAQTRRSTPLGQQQPAPRTRAAP     71 - 140
ALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTANSTNHCIKPVCEPPCQNRGSCSRPQLCVCR    141 - 210
SGFRGARCEEVIPDEEFDPQNSRLAPRRWAERSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPPAGTLS    211 - 280
GLSQTHPSQQHVGLSRTVRLHPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKK    281 - 350
IKIVFTPTICKQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPA    351 - 420
NSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVHIHHPPEASVQIHQ    421 - 490
VAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPLPPAAPRPRGLLGRCYLNTVN    491 - 560
GQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPVIENGQLECPQGYKRLNLTHCQDINECLTLG    561 - 630
LCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSR    631 - 700
VGKAWGSECEKCPLPGTEAFREICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAER    701 - 770
QPLRVVTDTWLEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTL    771 - 840
STPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKGRCINRVGSYS    841 - 910
CFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGYIMVRKGHCQDINECRHPGTC    911 - 980
PDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQ    981 - 1050
DVDECASRASCPTGLCLNTEGSFACSACENGYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDC   1051 - 1120
DGGYRPSPLGDSCEDVDECEDPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHG   1121 - 1190
ECLNSHGSFFCLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDI   1191 - 1260
DECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCDNTDGSFRCLC   1261 - 1330
DQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPRGAGGQSMSEAP   1331 - 1400
TGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQGASWGDACDLCPSEDSAEFSEICPSGKGYI   1401 - 1470
PVEGAWTFGQTMYTDADECVIFGPGLCPNGRCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACENG   1471 - 1540
ECVNTEGSFHCFCSPPLTLDLSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECC   1541 - 1610
CQDGEAWSQQCALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYL   1611 - 1680
GPEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVR   1681 - 1750
VREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCTAK   1751 - 1820
E//

Text Mined References (62)

PMID Year Title
27293371 2016 Screening of the LTBP2 gene in 214 Chinese sporadic CYP1B1-negative patients with primary congenital glaucoma.
26644005 2016 Co-localization of LTBP-2 with FGF-2 in fibrotic human keloid and hypertrophic scar.
26263555 2015 LTBP-2 Has a Single High-Affinity Binding Site for FGF-2 and Blocks FGF-2-Induced Cell Proliferation.
25974126 2015 NF-?B p65 Subunit Is Modulated by Latent Transforming Growth Factor-? Binding Protein 2 (LTBP2) in Nasopharyngeal Carcinoma HONE1 and HK1 Cells.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24908666 2014 Latent TGF-? binding protein-2 is essential for the development of ciliary zonule microfibrils.
24867584 2014 Confocal microscopy demonstrates association of LTBP-2 in fibrillin-1 microfibrils and colocalisation with perlecan in the disc cell pericellular matrix.
24803312 2015 Osteopontin and latent-TGF ? binding-protein 2 as potential diagnostic markers for HBV-related hepatocellular carcinoma.
24148803 2014 LTBP-2 competes with tropoelastin for binding to fibulin-5 and heparin, and is a negative modulator of elastinogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...