Property Summary

NCBI Gene PubMed Count 220
PubMed Score 320.40
PubTator Score 308.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Behcet's disease 89 3.549 1.8

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.000 3.1e-03
Astrocytoma, Pilocytic -1.800 1.8e-05
atypical teratoid / rhabdoid tumor -1.500 1.5e-04
Breast cancer -1.700 4.7e-02
cutaneous lupus erythematosus 1.400 2.3e-03
ependymoma -2.500 1.7e-03
glioblastoma -1.400 1.9e-05
group 3 medulloblastoma -2.100 9.3e-04
intraductal papillary-mucinous carcinoma... -1.500 3.9e-04
intraductal papillary-mucinous neoplasm ... -1.300 5.9e-03
lung cancer -1.900 2.6e-03
lung carcinoma -2.000 4.0e-20
malignant mesothelioma -2.500 2.4e-08
medulloblastoma, large-cell -1.500 9.8e-03
oligodendroglioma -2.200 6.5e-03
osteosarcoma -1.800 2.4e-03
pediatric high grade glioma -1.400 7.7e-05
Pick disease -1.700 1.0e-03
primary Sjogren syndrome 1.100 1.4e-02
primitive neuroectodermal tumor -1.500 1.4e-02
tuberculosis -1.300 4.1e-07
ulcerative colitis 1.200 9.0e-06

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (228)

AA Sequence

MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGR      1 - 70
VSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQ     71 - 140
RNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRK    141 - 210
EALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLE    211 - 280
EQSTKMTYEGDPIPMQRTHMLERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKL    281 - 350
PELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH    351 - 420
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPAT    421 - 490
LSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDL    491 - 560
IKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNK    561 - 630
GRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIP    631 - 700
ISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE                          701 - 748
//

Text Mined References (221)

PMID Year Title