Property Summary

NCBI Gene PubMed Count 201
Grant Count 203
R01 Count 133
Funding $19,301,290.84
PubMed Score 302.90
PubTator Score 308.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
astrocytic glioma -2.000 0.003
ependymoma -2.500 0.002
oligodendroglioma -2.200 0.007
cutaneous lupus erythematosus 1.400 0.002
glioblastoma -1.600 0.001
osteosarcoma -1.800 0.002
group 3 medulloblastoma -2.100 0.001
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.500 0.010
primitive neuroectodermal tumor -1.500 0.014
tuberculosis -1.300 0.000
intraductal papillary-mucinous carcinoma... -1.500 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.006
lung cancer -2.600 0.000
Breast cancer -1.700 0.047
pediatric high grade glioma -1.400 0.000
pilocytic astrocytoma -1.800 0.000
primary Sjogren syndrome 1.100 0.014
lung carcinoma -2.000 0.000
Pick disease -1.700 0.001
ulcerative colitis 1.200 0.000

Synonym

Accession Q14765 Q96NZ6
Symbols SLEB11

Gene

PANTHER Protein Class (1)

 GO Component (2)

Gene RIF (210)

PMID Text
26782418 Our findings indicate that although STAT4 and IFIH1 SNPs are not associated with T1D in a Brazilian population, they might play a role in susceptibility to T1D on a larger worldwide scale
26745093 SNP rs7574865 in STAT4 might contribute to progression to Hepatocellular Carcinoma.
26704347 STAT4 protein genetic variation is a prognostic factor predicting the treatment with interferon-alpha therapy in chronic hepatitis B.
26569609 the presence of the rs7574865 T allele enhances STAT4 mRNA transcription and protein expression
26538132 Five SNPs (rs7574865 in STAT4, rs9267673 near C2, rs2647073 and rs3997872 near HLA-DRB1 and rs9275319 near HLA-DQ), were found to be significantly associated with the risk of HBV-related LC.
26097239 CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.
26066297 There is a significant association between STAT4 rs7574865 polymorphism and IBD susceptibility in overall population.
25963842 gene polymorphisms along with Ptpn22 polymorphism confers susceptibility to rheumatoid arthritis in all major ethnic groups. [meta-analysis]
25913043 our replication study showed that the rs7574865 in STAT4 and rs9275319 in HLA-DQ were not associated with CHB-related HCC in a Korean population.
25864744 Increased expression of STAT4 is positively correlated with the depth of invasion in colorectal cancer patients.
More...

AA Sequence

MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGR      1 - 70
VSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQ     71 - 140
RNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRK    141 - 210
EALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLE    211 - 280
EQSTKMTYEGDPIPMQRTHMLERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKL    281 - 350
PELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH    351 - 420
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPAT    421 - 490
LSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDL    491 - 560
IKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNK    561 - 630
GRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIP    631 - 700
ISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE                          701 - 748
//

Text Mined References (202)

PMID Year Title
26782418 2015 Meta-analysis of STAT4 and IFIH1 polymorphisms in type 1 diabetes mellitus patients with autoimmune polyglandular syndrome type III.
26745093 2015 Single Nucleotide Polymorphisms in STAT3 and STAT4 and Risk of Hepatocellular Carcinoma in Thai Patients with Chronic Hepatitis B.
26704347 2016 Genetic variation in STAT4 predicts response to interferon-? therapy for hepatitis B e antigen-positive chronic hepatitis B.
26569609 2015 The Minor Allele of rs7574865 in the STAT4 Gene Is Associated with Increased mRNA and Protein Expression.
26538132 2015 Genetic variations in STAT4,C2,HLA-DRB1 and HLA-DQ associated with risk of hepatitis B virus-related liver cirrhosis.
26097239 2015 Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behçet's disease in Iranians.
26066297 2015 Association of STAT4 rs7574865 polymorphism with susceptibility to inflammatory bowel disease: A systematic review and meta-analysis.
25963842 2015 Association of PTPN22 rs2476601 and STAT4 rs7574865 polymorphisms with rheumatoid arthritis: A meta-analysis update.
25913043 2015 Replication of genome wide association studies on hepatocellular carcinoma susceptibility loci of STAT4 and HLA-DQ in a Korean population.
25864744 Silencing of stat4 gene inhibits cell proliferation and invasion of colorectal cancer cells.
More...