Property Summary

NCBI Gene PubMed Count 100
Grant Count 27
R01 Count 12
Funding $2,356,654.49
PubMed Score 241.87
PubTator Score 222.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (66)

PMID Text
26754263 We believe that for the first time, genetic variants at XRCC6 and MVP genes are associated with risk of more aggressive disease, and would be taken into account when assessing the malignancy of prostate cancer
26632382 NSCLCs [ non-small cell lung cancer ] expressing P-gp [P-glycoprotein ]/LRP [ lung resistance-related protein] bear the EGFR [epidermal growth factor receptor] mutation in exon 19 or 21 easily.
26476776 MVP genetic polymorphisms and haplotypes may not be associated with drug resistance of partial epilepsy in the Chinese Han population.
25869624 The association of MVP amplification and PTEN deletion could be a potential biomarker in glioblastoma.
25603048 LDL increases ABCB1, ABCC1, and LRP expression in a human doxorubicin-resistant uterine sarcoma cell line.
24997994 Bag3-MVP is an important complex that regulates a potent prosurvival signaling pathway and contributes to chemotherapy resistance in breast cancer
24243798 Study demonstrates that vaults have a tumour-promoting potential by stabilizing EGFR/PI3K-mediated migration and survival pathways in human glioblastoma.
24173679 USF1 binding to an E-box element may be critical for basal MVP promoter activation.
23820674 hyperosmotic stress upregulates Sp1 expression levels by inhibiting ubiquitination through the activation of JNK, and the induction of Sp1 expression directly enhances MVP transcription.
23751308 rs4788187, rs3815824, rs3815823 variants of the MVP gene are associated neither with predisposition for epilepsy nor with AED-resistance in the population that we have studied.
More...

AA Sequence

MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQ      1 - 70
GLVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAG     71 - 140
DEWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEWLVTTVGAYLPAVFE    141 - 210
EVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHN    211 - 280
YCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVS    281 - 350
HQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELP    351 - 420
PGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLG    421 - 490
PEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFEVNDRKDPQETAK    491 - 560
LFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQ    561 - 630
NGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAE    631 - 700
KARKELLELEALSMAVESTGTAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELQRVQKVRELEL    701 - 770
VYARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPIN    771 - 840
LFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR                     841 - 893
//

Text Mined References (106)

PMID Year Title
26754263 2016 Association between single-nucleotide polymorphisms in DNA double-strand break repair genes and prostate cancer aggressiveness in the Spanish population.
26632382 2016 Concomitance of P-gp/LRP Expression with EGFR Mutations in Exons 19 and 21 in Non-Small Cell Lung Cancers.
26476776 2015 Absence of association between major vault protein (MVP) gene polymorphisms and drug resistance in Chinese Han patients with partial epilepsy.
25869624 2015 Alteration of major vault protein in human glioblastoma and its relation with EGFR and PTEN status.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25603048 2015 ABCB1, ABCC1, and LRP gene expressions are altered by LDL, HDL, and serum deprivation in a human doxorubicin-resistant uterine sarcoma cell line.
25416956 2014 A proteome-scale map of the human interactome network.
24997994 2015 Proteomic analysis reveals a role for Bcl2-associated athanogene 3 and major vault protein in resistance to apoptosis in senescent cells by regulating ERK1/2 activation.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...