Property Summary

NCBI Gene PubMed Count 44
PubMed Score 40.83
PubTator Score 85.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

AA Sequence

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV      1 - 70
DSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLG     71 - 140
NSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVL    141 - 210
IVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQ    211 - 280
TYIPCYFIHVLKRTD                                                           281 - 295
//

Text Mined References (47)

PMID Year Title