Property Summary

NCBI Gene PubMed Count 42
Grant Count 34
R01 Count 25
Funding $4,754,619.39
PubMed Score 41.02
PubTator Score 85.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
24800880 In men of European descent, the GNMT rs10948059 and short tandem repeat polymorphism 1 were associated with prostate cancer risk.
23997240 The studies identify GNMT as a direct transcriptional target of the AR.
23883094 GNMT is an androgen receptor-targeted gene with its functional androgen response element located at +19/+33 of the first exon.
23475283 DNA hypermethylation plays an important role in the repression of GNMT in hepatocellular carcinoma (HCC), and loss of GNMT in human HCC could promote the establishment of aberrant DNA methylation patterns at specific gene promoters
22850906 single-nucleotide polymorphisms in VEGF, IL-10 and GNMT genes might have a synergistic role in the development of Prostate cancer
22807109 Report SNPs that are highly associated with hepatic GNMT protein expression and the coordinate regulation of MAT1A levels.
22415010 GNMT is a crucial regulator in cholesterol metabolism and in inflammation, and contributes to the pathogenesis of atherosclerosis.
22264868 GNMT plays important role in maintaining normal function of brain; lack of GNMT causes dysfunction of important signaling pathways and results in alterations of neurotransmitter secretion as well as changes in neuropsychological behavior.
22183894 This is the first report demonstrating that GNMT plays an important role in regulating cholesterol homeostasis via interaction with NPC2
22160218 In conclusion, GNMT regulates hepatocellular carcinoma growth in part through interacting with DEPDC6/DEPTOR and modulating mTOR/raptor signaling pathway
More...

AA Sequence

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGV      1 - 70
DSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLG     71 - 140
NSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVL    141 - 210
IVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQ    211 - 280
TYIPCYFIHVLKRTD                                                           281 - 295
//

Text Mined References (45)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24800880 2014 Genetic polymorphisms of the glycine N-methyltransferase and prostate cancer risk in the health professionals follow-up study.
24651765 2014 Genome-wide meta-analysis of homocysteine and methionine metabolism identifies five one carbon metabolism loci and a novel association of ALDH1L1 with ischemic stroke.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23997240 2013 Characterisation of the androgen regulation of glycine N-methyltransferase in prostate cancer cells.
23883094 2013 Androgen response element of the glycine N-methyltransferase gene is located in the coding region of its first exon.
23475283 2013 A DNA methylation signature associated with the epigenetic repression of glycine N-methyltransferase in human hepatocellular carcinoma.
22850906 2013 Genetic factors regulating inflammation and DNA methylation associated with prostate cancer.
22807109 2012 Human liver methionine cycle: MAT1A and GNMT gene resequencing, functional genomics, and hepatic genotype-phenotype correlation.
22415010 2012 Deficiency of glycine N-methyltransferase aggravates atherosclerosis in apolipoprotein E-null mice.
More...