Property Summary

NCBI Gene PubMed Count 34
Grant Count 1
R01 Count 1
Funding $64,584
PubMed Score 3.33
PubTator Score 3.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -1.174 0.018

Synonym

Accession Q14738 A8K3I9 B5BUA6 O00494 O00696 Q15171 Q5TC39
Symbols B56D
MRD35

Gene

 Grant Application (1)

Gene RIF (24)

PMID Text
26576547 Mutations in PPP2R5D are genetic cause of intellectual disability.
26168268 Mutant B56delta was A and C binding-deficient, while mutant Aalpha subunits bound B56delta well but were unable to bind C
25972378 Mutations in the PP2A regulatory subunit B family genes PPP2R5B, PPP2R5C and PPP2R5D cause human overgrowth
25772595 MiR-9 regulates GR signaling and steroid-resistant airway hyperresponsiveness by reducing protein phosphatase 2A activity.
25246613 PP2A-B56delta is the single most significant contributor, of the PP2A holoenzyme subunits, to BubR1 and Bub1 kinetochore localization.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20423611 Protein kinase A mediated activation of protein phosphatase 2A is enabled by PPP2R5D phosphorylation, which modulates the affinity of the protein phosphatase 2A holoenzyme to its physiological substrates.
More...

AA Sequence

MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLS      1 - 70
KIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLK     71 - 140
FKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHL    141 - 210
QLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQI    211 - 280
NHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQF    281 - 350
LEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE    351 - 420
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKA    421 - 490
EKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLK    491 - 560
DIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL                                561 - 602
//

Text Mined References (44)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26576547 2016 De novo missense variants in PPP2R5D are associated with intellectual disability, macrocephaly, hypotonia, and autism.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26168268 2015 B56?-related protein phosphatase 2A dysfunction identified in patients with intellectual disability.
25972378 2015 Mutations in the PP2A regulatory subunit B family genes PPP2R5B, PPP2R5C and PPP2R5D cause human overgrowth.
25772595 2015 MicroRNA-9 regulates steroid-resistant airway hyperresponsiveness by reducing protein phosphatase 2A activity.
25533962 2015 Large-scale discovery of novel genetic causes of developmental disorders.
25416956 2014 A proteome-scale map of the human interactome network.
25246613 2014 PP2A-B56 opposes Mps1 phosphorylation of Knl1 and thereby promotes spindle assembly checkpoint silencing.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
More...