Property Summary

NCBI Gene PubMed Count 36
PubMed Score 3.59
PubTator Score 3.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -1.174 1.8e-02

Gene RIF (20)

AA Sequence

MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLS      1 - 70
KIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLK     71 - 140
FKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHL    141 - 210
QLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQI    211 - 280
NHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQF    281 - 350
LEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE    351 - 420
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKA    421 - 490
EKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLK    491 - 560
DIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL                                561 - 602
//

Text Mined References (46)

PMID Year Title