Property Summary

NCBI Gene PubMed Count 30
PubMed Score 56.32
PubTator Score 33.35

Knowledge Summary

Patent (1,214)

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.200 3.9e-03
Alzheimer's disease -1.200 4.8e-02
astrocytic glioma -2.700 2.2e-03
atypical teratoid / rhabdoid tumor -1.100 5.4e-04
Breast cancer -2.000 5.8e-12
colon cancer -1.100 1.0e-02
ductal carcinoma in situ -1.800 9.8e-03
ependymoma -3.100 3.1e-03
glioblastoma -1.300 8.9e-06
group 3 medulloblastoma -2.000 2.4e-02
invasive ductal carcinoma -2.800 1.5e-03
lung cancer -1.100 3.2e-03
medulloblastoma, large-cell -1.100 1.9e-02
non-small cell lung cancer -1.622 9.9e-17
oligodendroglioma -1.600 1.2e-02
osteosarcoma 1.184 1.7e-04
ovarian cancer -1.800 4.3e-08
Pick disease -1.700 5.3e-04
primitive neuroectodermal tumor -1.100 7.4e-03
subependymal giant cell astrocytoma -1.869 4.4e-02

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQLALLREVEMNW      1 - 70
YLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAE     71 - 140
VYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFAN    141 - 210
RPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQ    211 - 280
LPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAER    281 - 350
LGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS     351 - 419
//

Text Mined References (35)

PMID Year Title