Property Summary

NCBI Gene PubMed Count 31
PubMed Score 48.73
PubTator Score 31.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.4e-13
psoriasis 6694 1.2e-07
malignant mesothelioma 3232 2.0e-06
atypical teratoid / rhabdoid tumor 5112 5.2e-05
Chronic Lymphocytic Leukemia 262 2.3e-04
ependymoma 4679 3.0e-04
Pick disease 1894 3.1e-04
primary pancreatic ductal adenocarcinoma 1109 3.4e-04
ovarian cancer 8520 4.4e-04
Atopic dermatitis 952 5.5e-04
invasive ductal carcinoma 2951 7.5e-04
osteosarcoma 7950 1.0e-03
Amyotrophic lateral sclerosis 451 1.4e-03
Duchenne muscular dystrophy 601 3.2e-03
ductal carcinoma in situ 1745 3.2e-03
head and neck cancer 271 3.2e-03
lung cancer 4740 4.0e-03
breast carcinoma 1638 4.2e-03
adrenocortical carcinoma 1428 4.2e-03
Astrocytoma, Pilocytic 3081 4.9e-03
medulloblastoma, large-cell 6241 7.1e-03
interstitial cystitis 2312 7.4e-03
limb girdle muscular dystrophy 2A 213 8.4e-03
glioblastoma 5792 8.4e-03
ulcerative colitis 1819 8.5e-03
acute quadriplegic myopathy 1158 9.1e-03
Becker muscular dystrophy 191 1.1e-02
astrocytic glioma 2597 1.1e-02
gastric cancer 459 1.7e-02
pancreatic carcinoma 562 1.7e-02
pancreatic cancer 2398 1.7e-02
colon cancer 1478 1.9e-02
primitive neuroectodermal tumor 3035 2.1e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 2.3e-02
intraductal papillary-mucinous adenoma (IPMA) 2955 2.8e-02
adult high grade glioma 3801 2.9e-02
dermatomyositis 966 3.0e-02
group 3 medulloblastoma 4104 3.3e-02
intraductal papillary-mucinous neoplasm (IPMN) 3291 3.6e-02
intraductal papillary-mucinous carcinoma (IPMC) 2989 3.9e-02
Disease Target Count Z-score Confidence
Muscular dystrophy 75 5.263 2.6
Adrenal carcinoma 3 3.501 1.8
Filariasis 21 3.126 1.6

Expression

  Differential Expression (40)

Disease log2 FC p
acute quadriplegic myopathy -1.214 9.1e-03
adrenocortical carcinoma -1.434 4.2e-03
adult high grade glioma 1.100 2.9e-02
Amyotrophic lateral sclerosis -1.154 1.4e-03
astrocytic glioma 1.100 1.1e-02
Astrocytoma, Pilocytic 1.200 4.9e-03
Atopic dermatitis -1.400 5.5e-04
atypical teratoid / rhabdoid tumor -1.900 5.2e-05
autosomal dominant Emery-Dreifuss muscul... -1.276 2.3e-02
Becker muscular dystrophy -1.460 1.1e-02
Breast cancer -2.100 1.4e-13
breast carcinoma -1.100 4.2e-03
Chronic Lymphocytic Leukemia -1.044 2.3e-04
colon cancer -2.000 1.9e-02
dermatomyositis 1.100 3.0e-02
Duchenne muscular dystrophy -1.143 3.2e-03
ductal carcinoma in situ -1.200 3.2e-03
ependymoma 1.300 3.0e-04
gastric cancer 1.300 1.7e-02
glioblastoma 1.300 8.4e-03
group 3 medulloblastoma -1.400 3.3e-02
head and neck cancer -1.200 3.2e-03
interstitial cystitis -1.100 7.4e-03
intraductal papillary-mucinous adenoma (... -1.500 2.8e-02
intraductal papillary-mucinous carcinoma... -1.300 3.9e-02
intraductal papillary-mucinous neoplasm ... -1.300 3.6e-02
invasive ductal carcinoma -2.200 7.5e-04
limb girdle muscular dystrophy 2A -1.171 8.4e-03
lung cancer -1.100 4.0e-03
malignant mesothelioma -3.900 2.0e-06
medulloblastoma, large-cell -1.600 7.1e-03
osteosarcoma 2.889 1.0e-03
ovarian cancer -1.600 4.4e-04
pancreatic cancer 1.400 1.7e-02
pancreatic carcinoma 1.400 1.7e-02
Pick disease 2.400 3.1e-04
primary pancreatic ductal adenocarcinoma 2.061 3.4e-04
primitive neuroectodermal tumor -1.300 2.1e-02
psoriasis -2.200 1.2e-07
ulcerative colitis -1.100 8.5e-03

Gene RIF (14)

AA Sequence

MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV      1 - 70
GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV     71 - 140
AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL    141 - 210
LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI                                         211 - 243
//

Text Mined References (32)

PMID Year Title