Property Summary

NCBI Gene PubMed Count 29
Grant Count 35
R01 Count 27
Funding $3,135,448.07
PubMed Score 44.65
PubTator Score 31.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (40)

Gene RIF (12)

PMID Text
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18981229 Human SSPN in transgegnic mice directly interacts with utrophin-glycoprotein comlpex and functions to stabilize utrophin protein without increasing utrophin transcription.
18830929 decreased expression of sarcospan at the Fukuyama congenital muscular dystrophy myofiber surfaces.
18028944 crystal structure of Imp beta (127-876) in complex SPN1 (1-65) at 2.8-A resolution reveals that Imp beta adopts an open conformation, which is unique for a functional Imp beta/cargo complex, and resembles the conformation of the Imp beta/RanGTP complex
17311848 Sarcospan plays an important mechanical role in stabilizing the dystrophin-glycoprotein complex.
15375499 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11956653 Frequent polymorphism of peroxisome proliferator activated receptor gamma gene in colorectal cancer containing wild-type K-ras gene.
11807778 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV      1 - 70
GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV     71 - 140
AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL    141 - 210
LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI                                         211 - 243
//

Text Mined References (30)

PMID Year Title
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18981229 2008 Sarcospan reduces dystrophic pathology: stabilization of the utrophin-glycoprotein complex.
18830929 2008 Reduced expression of sarcospan in muscles of Fukuyama congenital muscular dystrophy.
18028944 2007 Structural basis for RanGTP independent entry of spliceosomal U snRNPs into the nucleus.
17311848 2007 Disrupted mechanical stability of the dystrophin-glycoprotein complex causes severe muscular dystrophy in sarcospan transgenic mice.
16823602 2006 Over-expression of Microspan, a novel component of the sarcoplasmic reticulum, causes severe muscle pathology with triad abnormalities.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
More...