Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.13
PubTator Score 6.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14699 Q0D2G0 Q496Y2 Q4QQI7 Q5JB48 Q7Z7P2
Symbols MIG2
PIG9
PIB10
RAFTLIN

Gene

 GO Function (1)

Gene RIF (6)

PMID Text
23645746 Mitogen-inducible Gene-2 expression is reduced in breast cancer.
22222511 combination of ATOH7 and RFTN1 SNPs increased risk to POAG, indicating their diversified effects in the complex genetics of glaucoma.
21266579 Raftlin cooperates with the uptake receptor to mediate cell entry of poly(I:C), which is critical for activation of TLR3.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
12805216 These data suggest that Raftlin plays a pivotal role in the formation and/or maintenance of lipid rafts, therefore regulating B-cell antigen receptor-mediated signaling.

AA Sequence

MGCGLNKLEKRDEKRPGNIYSTLKRPQVETKIDVSYEYRFLEFTTLSAAELPGSSAVRLASLRDLPAQLL      1 - 70
ELYQQGFSLAALHPFVQPTHEREKTPLEHIFRAILIKKTDRSQKTDLHNEGYILELDCCSSLDHPTDQKL     71 - 140
IPEFIKKIQEAASQGLKFVGVIPQYHSSVNSAGSSAPVSTANSTEDARDAKNARGDHASLENEKPGTGDV    141 - 210
CSAPAGRNQSPEPSSGPRGEVPLAKQPSSPSGEGDGGELSPQGVSKTLDGPESNPLEVHEEPLSGKMEIF    211 - 280
TLFNKPKSHQKCRQYYPVTIPLHVSKNGQTVSGLDANWLEHMSDHFRKGGMLVNAVFYLGIVNDSLHGLT    281 - 350
DGVFIFEAVSTEDSKTIQGYDAIVVEQWTVLEGVEVQTDYVPLLNSLAAYGWQLTCVLPTPVVKTTSEGS    351 - 420
VSTKQIVFLQRPCLPQKIKKKESKFQWRFSREEMHNRQMRKSKGKLSARDKQQAEENEKNLEDQSSKAGD    421 - 490
MGNCVSGQQQEGGVSEEMKGPVQEDKGEQLSPGGLLCGVGVEGEAVQNGPASHSRALVGICTGHSNPGED    491 - 560
ARDGDAEEVRELGTVEEN                                                        561 - 578
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23645746 2013 Mitogen-inducible Gene-2 (MIG2) and migfilin expression is reduced in samples of human breast cancer.
22222511 2012 Interactive effects of ATOH7 and RFTN1 in association with adult-onset primary open-angle glaucoma.
21955986 2011 Characterization of a new ARID family transcription factor (Brightlike/ARID3C) that co-activates Bright/ARID3A-mediated immunoglobulin gene transcription.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...