Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.50
PubTator Score 6.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -1.177 1.9e-02
atypical teratoid / rhabdoid tumor -1.100 4.7e-02
Breast cancer 1.700 1.6e-07
chronic lymphosyte leukemia -1.500 1.9e-06
cystic fibrosis 1.100 3.8e-04
ductal carcinoma in situ -1.100 2.4e-02
fibroadenoma -1.700 2.1e-02
gastric carcinoma 1.800 1.3e-02
group 4 medulloblastoma -1.700 7.1e-03
interstitial cystitis 1.600 7.3e-04
intraductal papillary-mucinous adenoma (... -2.000 6.5e-03
intraductal papillary-mucinous carcinoma... -2.200 6.8e-03
invasive ductal carcinoma -1.500 9.2e-03
lung adenocarcinoma -1.100 1.6e-05
lung cancer -1.400 5.1e-05
lung carcinoma -1.300 3.3e-19
malignant mesothelioma -1.500 3.2e-07
medulloblastoma, large-cell -2.400 3.9e-05
non-small cell lung cancer -1.406 4.9e-17
ovarian cancer -2.500 8.8e-06
pancreatic cancer 2.600 3.1e-04
primary pancreatic ductal adenocarcinoma 2.697 8.5e-05
primary Sjogren syndrome 1.900 1.4e-04
sarcoidosis -1.100 1.5e-05
subependymal giant cell astrocytoma 1.739 2.4e-02
ulcerative colitis 2.900 9.1e-06
Waldenstrons macroglobulinemia -1.824 3.4e-02

 GO Function (1)

Gene RIF (7)

AA Sequence

MGCGLNKLEKRDEKRPGNIYSTLKRPQVETKIDVSYEYRFLEFTTLSAAELPGSSAVRLASLRDLPAQLL      1 - 70
ELYQQGFSLAALHPFVQPTHEREKTPLEHIFRAILIKKTDRSQKTDLHNEGYILELDCCSSLDHPTDQKL     71 - 140
IPEFIKKIQEAASQGLKFVGVIPQYHSSVNSAGSSAPVSTANSTEDARDAKNARGDHASLENEKPGTGDV    141 - 210
CSAPAGRNQSPEPSSGPRGEVPLAKQPSSPSGEGDGGELSPQGVSKTLDGPESNPLEVHEEPLSGKMEIF    211 - 280
TLFNKPKSHQKCRQYYPVTIPLHVSKNGQTVSGLDANWLEHMSDHFRKGGMLVNAVFYLGIVNDSLHGLT    281 - 350
DGVFIFEAVSTEDSKTIQGYDAIVVEQWTVLEGVEVQTDYVPLLNSLAAYGWQLTCVLPTPVVKTTSEGS    351 - 420
VSTKQIVFLQRPCLPQKIKKKESKFQWRFSREEMHNRQMRKSKGKLSARDKQQAEENEKNLEDQSSKAGD    421 - 490
MGNCVSGQQQEGGVSEEMKGPVQEDKGEQLSPGGLLCGVGVEGEAVQNGPASHSRALVGICTGHSNPGED    491 - 560
ARDGDAEEVRELGTVEEN                                                        561 - 578
//

Text Mined References (21)

PMID Year Title