Property Summary

NCBI Gene PubMed Count 30
PubMed Score 82.43
PubTator Score 3.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 1.300 0.006
oligodendroglioma 1.100 0.005
psoriasis -2.300 0.000
osteosarcoma 1.407 0.000
glioblastoma 1.500 0.000
medulloblastoma 1.200 0.000
astrocytoma 1.500 0.004
atypical teratoid/rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 1.600 0.000
lung cancer 1.800 0.000
diabetes mellitus -1.300 0.008
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.100 0.000
lung adenocarcinoma 1.271 0.000

Synonym

Accession Q14697 A6NC20 Q8WTS9 Q9P0X0
Symbols G2AN
GIIA
PKD3
GLUII

Gene

PANTHER Protein Class (2)

Gene RIF (39)

PMID Text
24008518 The high frequency of glucosidase II overexpression, which to the best of our knowledge has not been previously described, indicates its crucial roles in lung tumorigenesis and is thus a valuable biomarker
22190034 HIV-1 gp120 is identified to have a physical interaction with glucosidase, alpha; neutral AB (GANAB) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp120 is identified to have a physical interaction with glucosidase, alpha; neutral AB (GANAB) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21642380 Loss of the tumor suppression function of Hsp60 or GANAB contribute to aggressive cancers.
19737279 In males being treated for infertility, neutral alpha-glucosidase activity correlated with the percentage of sperm DNA fragmentation.
18854154 Knockdown of glucosidase, alpha; neutral AB (GANAB) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 18 is discussed
16547752 HIV-1 gp120 is identified to have a physical interaction with glucosidase, alpha; neutral AB (GANAB) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12719582 HIV-1 gp120 is identified to have a physical interaction with glucosidase, alpha; neutral AB (GANAB) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12560567 HIV-1 gp120 is identified to have a physical interaction with glucosidase, alpha; neutral AB (GANAB) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPYRALLDSLQLG      1 - 70
PDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVEL     71 - 140
TMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDGDK    141 - 210
PEETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLY    211 - 280
NLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQ    281 - 350
TDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN    351 - 420
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVHEELRNLGLYV    421 - 490
KTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDA    491 - 560
QHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVLARAFFAGSQRFGAVWTGDNTAEWDHLKISI    561 - 630
PMCLSLGLVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDA    631 - 700
LGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLP    701 - 770
GQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA    771 - 840
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGS    841 - 910
PESRLSFQHDPETSVLVLRKPGINVASDWSIHLR                                        911 - 944
//

Text Mined References (35)

PMID Year Title
27259053 2016 Mutations in GANAB, Encoding the Glucosidase II? Subunit, Cause Autosomal-Dominant Polycystic Kidney and Liver Disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25658244 2014 Impact of exposure to low concentrations of nitric oxide on protein profile in murine and human pancreatic islet cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24008518 2013 Glucosidase II exhibits similarity to the p53 tumor suppressor in regards to structure and behavior in response to stress signals: a potential novel cancer biomarker.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...