Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.46
PubTator Score 26.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Gene RIF (8)

AA Sequence

MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQW      1 - 70
EKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSL     71 - 140
FNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKK    141 - 210
KKEGDLKSRSSKEENRAGNKREDL                                                  211 - 234
//

Text Mined References (24)

PMID Year Title