Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $460,381
PubMed Score 25.26
PubTator Score 26.61

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
23469146 Mesd C-terminal region constitutes the major LRP5/6-binding domain, and that Mesd protein and its C-terminal region peptide have a potential therapeutic value in cancer
22190034 HIV-1 gp160 is identified to have a physical interaction with mesoderm development candidate 2 (MESDC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21907199 Results indicate that Mesd is a universal inhibitor of Wnt/LRP signaling on the cell surface.
21397183 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/LRP6.
21337463 Results provide evidence that MESD functions as a general LRP chaperone and suggest that the Mesd phenotype results from both signaling and endocytic defects resulting from misfolding of multiple LRP receptors.
19746449 a high bone mass mutant LRP5(G171V), has subtly reduced Dkk1 binding, and, in contrast to LRP5, no enhancement of binding with MesD
16989816 Mesd and LRP6 modulate Wnt signaling.
15917269 as a result of (12;15)(q13;q25)translocation, the SUMO/Sentrin-specific protease 1 gene (SENP1) on chromosome 12 and the embryonic polarity-related mesoderm development gene (MESDC2) on chromosome 15 are disrupted and fused

AA Sequence

MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQW      1 - 70
EKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSL     71 - 140
FNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKK    141 - 210
KKEGDLKSRSSKEENRAGNKREDL                                                  211 - 234
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23469146 2013 The C-terminal region Mesd peptide mimics full-length Mesd and acts as an inhibitor of Wnt/?-catenin signaling in cancer cells.
21907199 2011 Mesd is a general inhibitor of different Wnt ligands in Wnt/LRP signaling and inhibits PC-3 tumor growth in vivo.
21397183 2011 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/6.
21337463 2011 MESD is essential for apical localization of megalin/LRP2 in the visceral endoderm.
21269460 2011 Initial characterization of the human central proteome.
19746449 2009 A cell-based Dkk1 binding assay reveals roles for extracellular domains of LRP5 in Dkk1 interaction and highlights differences between wild-type and the high bone mass mutant LRP5(G171V).
17488095 2007 Requirement for natively unstructured regions of mesoderm development candidate 2 in promoting low-density lipoprotein receptor-related protein 6 maturation.
16989816 2006 Modulation of LRP6-mediated Wnt signaling by molecular chaperone Mesd.
More...