Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung cancer 4,466

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.100 0.046

Synonym

Accession Q14695 A1A524 Q75MW1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEAWESSQPLLRCEIPCPLPGTDRDGSVSLPGEAASCDLDTLEPEHGNRRVSGNPISVCWAYKVTKVKCW      1 - 70
SVRERGGRHIGGPRSTLKHPAHHGMGKNLATSLPTAASLGLGKGQLLVSIRFMDTTKKRGQSETFNIC       71 - 138
//

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
9847074 1998 Toward a complete human genome sequence.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.