Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 4.6e-02
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.100 4.6e-02

 Compartment GO Term (0)

AA Sequence

MEAWESSQPLLRCEIPCPLPGTDRDGSVSLPGEAASCDLDTLEPEHGNRRVSGNPISVCWAYKVTKVKCW      1 - 70
SVRERGGRHIGGPRSTLKHPAHHGMGKNLATSLPTAASLGLGKGQLLVSIRFMDTTKKRGQSETFNIC       71 - 138
//

Text Mined References (8)

PMID Year Title