Property Summary

NCBI Gene PubMed Count 37
Grant Count 19
R01 Count 18
Funding $1,257,205.54
PubMed Score 6.84
PubTator Score 22.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 0.000

Gene RIF (16)

PMID Text
27022092 G3BP mediates the condensation of stress granules by shifting between two different states that are controlled by the phosphorylation of S149 and by binding to Caprin1 or USP10.
26876938 Data demonstrated that AMPK-USP10 form a positive feedforward loop that ensures amplification of AMPK activation in response to fluctuation of cellular energy status.
26555087 Investigate the expression of USP10 in the human normal adrenal gland and various adrenal tumors. In adrenal tumors, detectable levels of USP10 protein were found in 100 % (30/30) adrenocortical adenomas, 88.89 % (8/9) adrenocortical carcinomas, and 10 % (2/20) pheochromocytomas.
25168367 miR-191 could promote pancreatic cancer progression through targeting USP10, implicating a novel mechanism for the tumorigenesis.
24845384 this study identified USP10, a carboxyl-terminal ubiquitin-processing protease, could interact with T-bet in the nucleus.
24332849 USP10 deubiquitinates and stabilizes SIRT6.
24270572 USP10 inhibits genotoxic NF-kappaB activation by MCPIP1-facilitated deubiquitination of NEMO.
23775713 USP10 is a host factor that inhibits stress-induced reactive oxygen species production and apoptosis in HTLV-1-infected T cells.
21962518 USP10 mediates the deubiquitination of p53, regulating deubiquitination activity of USP10 and USP13 by Beclin1 provides a mechanism for Beclin1 to control the levels of p53.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFGVDEVIEPSDT      1 - 70
LPRTPSYSISSTLNPQAPEFILGCTASKITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGV     71 - 140
SGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPSVTPRTCN    141 - 210
SPQNSTDSVSDIVPDSPFPGALGSDTRTAGQPEGGPGADFGQSCFPAEAGRDTLSRTAGAQPCVGTDTTE    211 - 280
NLGVANGQILESSGEGTATNGVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSK    281 - 350
PSSSSPVAYVETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINK    351 - 420
GNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIV    421 - 490
RDIRPGAAFEPTYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLHEEMLNLKKLLSPSNEKLTISNGPK    491 - 560
NHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQADFVQTPITGIFGGHIRSVVYQQSSKESATLQPFFT    561 - 630
LQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKL    631 - 700
IKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTV    701 - 770
KVINQYQVVKPTAERTAYLLYYRRVDLL                                              771 - 798
//

Text Mined References (51)

PMID Year Title
27022092 2016 G3BP-Caprin1-USP10 complexes mediate stress granule condensation and associate with 40S subunits.
26876938 2016 Deubiquitination and Activation of AMPK by USP10.
26555087 2015 USP10 Expression in Normal Adrenal Gland and Various Adrenal Tumors.
25861989 2015 TRAF Family Member-associated NF-?B Activator (TANK) Inhibits Genotoxic Nuclear Factor ?B Activation by Facilitating Deubiquitinase USP10-dependent Deubiquitination of TRAF6 Ligase.
25416956 2014 A proteome-scale map of the human interactome network.
25168367 2014 MicroRNA-191 promotes pancreatic cancer progression by targeting USP10.
24845384 2014 Deubiquitination and stabilization of T-bet by USP10.
24332849 2013 USP10 antagonizes c-Myc transcriptional activation through SIRT6 stabilization to suppress tumor formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270572 2013 USP10 inhibits genotoxic NF-?B activation by MCPIP1-facilitated deubiquitination of NEMO.
More...