Property Summary

NCBI Gene PubMed Count 81
PubMed Score 149.52
PubTator Score 106.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Myoglobinuria, Acute Recurrent, Autosomal Recessive 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 2.380 1.6e-03
active ulcerative colitis 2.295 3.7e-03
adult high grade glioma -1.200 1.1e-03
Amyotrophic lateral sclerosis -1.118 7.6e-05
astrocytic glioma 1.500 5.7e-03
autosomal dominant Emery-Dreifuss muscul... -1.262 7.1e-03
Becker muscular dystrophy -1.089 1.0e-02
breast carcinoma -1.100 8.0e-04
Chronic Lymphocytic Leukemia -1.519 8.8e-07
dermatomyositis -1.800 8.5e-04
Duchenne muscular dystrophy -1.068 1.7e-04
esophageal adenocarcinoma -1.200 1.8e-02
Gaucher disease type 1 -1.500 3.3e-02
hereditary spastic paraplegia -1.119 1.3e-02
intraductal papillary-mucinous carcinoma... 1.600 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.600 6.6e-03
limb girdle muscular dystrophy 2A -1.106 5.1e-04
lung cancer -1.400 1.4e-02
medulloblastoma, large-cell 1.300 1.7e-03
oligodendroglioma 1.200 6.0e-03
osteosarcoma 2.380 5.5e-08
ovarian cancer -1.300 9.4e-05
Pick disease -1.100 3.7e-05
primary pancreatic ductal adenocarcinoma 1.329 3.1e-02
psoriasis -1.400 4.0e-07

Gene RIF (65)

AA Sequence

MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRSREKVVDIEIN      1 - 70
GESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVI     71 - 140
APSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRTLPNDIPPFQD    141 - 210
DIPEENLSLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQKNPEMLWLWGELPQ    211 - 280
AAKSSSPHKMKESSPLSSRKICDKSHFQAIHSESSDTFSDQSPTLVGGALLDQNKPQTEMQFVNEEDLET    281 - 350
LGAAAPLLPMIEELKPPSASVVQTANKTDSPSRKRDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDP    351 - 420
SGLAKHASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITKDAFLEQAVSY    421 - 490
QQFVDNPAIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVESIMRDKMPKKGGRWWFSWRGR    491 - 560
NTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSSSDEERAAAKPSNAGHLPLLPNVSYKKTLRL    561 - 630
TSEQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDW    631 - 700
THQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEK    701 - 770
KPEKFKVQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYV    771 - 840
RLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA                        841 - 890
//

Text Mined References (87)

PMID Year Title