Property Summary

NCBI Gene PubMed Count 63
Grant Count 72
R01 Count 39
Funding $7,347,261.19
PubMed Score 135.01
PubTator Score 106.07

Knowledge Summary

Patent

No data available

Expression

Gene

Gene RIF (58)

PMID Text
26288136 lipin-1 has a critical role in the regulation of macrophage inflammatory responses to modified-LDL
26276647 Results of our study suggest that rs2716610: C>T polymorphism of LPIN1 gene could have a protective effect against development of metabolic syndrome, while rs11693809: C>T might affect a glucose control in patients with MS.
25974997 Lipin1beta might play a role in the pathogenesis of insulin resistance in gestational diabetes mellitus
25834103 Lipin-1 controls main cellular processes involved in cancer progression and that its targeting, alone or in combination with other treatments, could open new avenues in anticancer therapy.
25475986 LPIN1 plays a functional role in lipid synthesis and storage, a role which is highly conserved from human to yeast.
24558042 the lipin-1 N-terminal domain is important for its catalytic activity, nuclear localization, and binding to PP-1cgamma
23928362 Lipin-1 deficiency is associated with lipid metabolism alterations resulting in massive rhabdomyolysis.
23426382 the SNP in the LPIN1 gene (rs10192566) had no effect on the trough rosiglitazone steady-state concentration.
23426360 Phosphorylation of lipin 1 and charge on the phosphatidic acid head group control its phosphatidic acid phosphatase activity and membrane association
22853689 Data suggests common single nucleotide polymorphisms within the LPIN1 region were associated with Type 2 diabetes and metabolic traits in the Chinese population.
More...

AA Sequence

MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRSREKVVDIEIN      1 - 70
GESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVI     71 - 140
APSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRTLPNDIPPFQD    141 - 210
DIPEENLSLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQKNPEMLWLWGELPQ    211 - 280
AAKSSSPHKMKESSPLSSRKICDKSHFQAIHSESSDTFSDQSPTLVGGALLDQNKPQTEMQFVNEEDLET    281 - 350
LGAAAPLLPMIEELKPPSASVVQTANKTDSPSRKRDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDP    351 - 420
SGLAKHASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITKDAFLEQAVSY    421 - 490
QQFVDNPAIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVESIMRDKMPKKGGRWWFSWRGR    491 - 560
NTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSSSDEERAAAKPSNAGHLPLLPNVSYKKTLRL    561 - 630
TSEQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDW    631 - 700
THQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEK    701 - 770
KPEKFKVQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYV    771 - 840
RLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA                        841 - 890
//

Text Mined References (69)

PMID Year Title
26288136 2015 Lipin-1 contributes to modified low-density lipoprotein-elicited macrophage pro-inflammatory responses.
26276647 2015 Association of LPIN1 gene variations with markers of metabolic syndrome in population from Bosnia and Herzegovina.
25974997 2015 Changes of lipin1? expression in gestational diabetes mellitus.
25834103 2015 Lipin-1 regulates cancer cell phenotype and is a potential target to potentiate rapamycin treatment.
25475986 2014 Phosphatidate phosphatase-1 is functionally conserved in lipid synthesis and storage from human to yeast.
24558042 2014 Conserved residues in the N terminus of lipin-1 are required for binding to protein phosphatase-1c, nuclear translocation, and phosphatidate phosphatase activity.
23928362 2013 Combination of lipid metabolism alterations and their sensitivity to inflammatory cytokines in human lipin-1-deficient myoblasts.
23426382 2013 The role of genetic variants in CYP2C8, LPIN1, PPARGC1A and PPAR? on the trough steady-state plasma concentrations of rosiglitazone and on glycosylated haemoglobin A1c in type 2 diabetes.
23426360 2013 Phosphorylation of lipin 1 and charge on the phosphatidic acid head group control its phosphatidic acid phosphatase activity and membrane association.
22853689 2013 Genetic variants of LPIN1 indicate an association with Type 2 diabetes mellitus in a Chinese population.
More...