Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.62
PubTator Score 13.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 5.03954329523035E-36
non-small cell lung cancer 2798 7.92541975167607E-31
glioblastoma multiforme 347 1.30514190103092E-11
Breast cancer 3099 2.19584943641464E-11
psoriasis 6685 2.03214467381552E-10
lung adenocarcinoma 2714 5.98267462757644E-10
adrenocortical carcinoma 1427 3.87448040237592E-8
malignant mesothelioma 3163 2.07551240124677E-7
nasopharyngeal carcinoma 1056 2.45279503459165E-7
lung cancer 4473 1.64682908108344E-6
atypical teratoid/rhabdoid tumor 1095 4.60309925377643E-6
Atopic dermatitis 944 5.54588614045072E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.84647822561185E-5
pituitary cancer 1972 6.45852888276193E-5
medulloblastoma, large-cell 6234 1.39138943122967E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.55393573879534E-4
ovarian cancer 8492 2.7233447817811E-4
invasive ductal carcinoma 2950 2.81439142942935E-4
group 3 medulloblastoma 2254 5.56766426935936E-4
primitive neuroectodermal tumor 3031 0.00225525426862651
ductal carcinoma in situ 1745 0.0027281219626251
pediatric high grade glioma 2712 0.00312522722247024
Endometriosis 535 0.0147008748120648
esophageal adenocarcinoma 737 0.0226782012732855
pancreatic cancer 2300 0.0334361825022136
pancreatic carcinoma 567 0.0334361825022136
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0396657592607804

Expression

Synonym

Accession Q14691 Q9NQE2 Q9NQI7
Symbols PSF1

Gene

PANTHER Protein Class (1)

PDB

2E9X   2EHO   2Q9Q  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (5)

PMID Text
21713706 PSF1 mRNA expression was an independent factor associated with prognosis of colorectal cancer.
20825491 These results suggest that PSF1 over-expression is specifically involved in breast cancer cell growth.
20103637 Findings implicate PSF1 in tumorigenesis and offer initial evidence of its potential as a theranostic target.
17417653 the C-terminal domain of Psf1 does not contribute to the stability of the GINS complex but is crucial for chromatin binding and replication activity
17127213 expression of mammalian GINS is regulated by 17beta-Estradiol-stimulated estrogen receptor alpha, and PSF3 acts as a gene responsive to transcription factor E2F1

AA Sequence

MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLL      1 - 70
RNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDM     71 - 140
KPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS                  141 - 196
//

Text Mined References (19)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21713706 2011 [Expression and clinical significance of GINS complex in colorectal cancer].
21269460 2011 Initial characterization of the human central proteome.
20825491 2010 Up-regulation of PSF1 promotes the growth of breast cancer cells.
20103637 2010 PSF1, a DNA replication factor expressed widely in stem and progenitor cells, drives tumorigenic and metastatic properties.
17652513 2007 Crystal structure of the GINS complex and functional insights into its role in DNA replication.
17611626 2007 Comprehensive expression profiling of tumor cell lines identifies molecular signatures of melanoma progression.
17557111 2007 Molecular architecture of the human GINS complex.
17545466 2007 Crystal structure of the human GINS complex.
More...