Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.63
PubTator Score 13.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 3.260 3.9e-08
Atopic dermatitis 1.200 5.5e-05
atypical teratoid/rhabdoid tumor 1.400 4.6e-06
Breast cancer 2.000 2.2e-11
breast carcinoma 1.700 5.0e-36
ductal carcinoma in situ 2.300 2.7e-03
Endometriosis 1.596 1.5e-02
esophageal adenocarcinoma 1.200 2.3e-02
glioblastoma 1.500 4.3e-05
group 3 medulloblastoma 2.200 5.6e-04
intraductal papillary-mucinous carcinoma... 3.000 5.8e-05
intraductal papillary-mucinous neoplasm ... 3.600 2.6e-04
invasive ductal carcinoma 3.100 2.8e-04
lung adenocarcinoma 1.400 6.0e-10
lung cancer 3.600 7.1e-06
malignant mesothelioma 1.700 2.1e-07
medulloblastoma, large-cell 1.400 1.4e-04
nasopharyngeal carcinoma 1.900 2.5e-07
non-small cell lung cancer 3.481 7.9e-31
ovarian cancer 1.600 2.7e-04
pancreatic cancer 1.200 3.3e-02
pancreatic carcinoma 1.200 3.3e-02
pancreatic ductal adenocarcinoma liver m... 1.262 4.0e-02
pediatric high grade glioma 1.300 3.1e-03
pituitary cancer 1.400 6.5e-05
primitive neuroectodermal tumor 1.200 2.3e-03
psoriasis 1.100 1.0e-26

Synonym

Accession Q14691 Q9NQE2 Q9NQI7
Symbols PSF1

Gene

PANTHER Protein Class (1)

PDB

2E9X   2EHO   2Q9Q  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (6)

AA Sequence

MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLL      1 - 70
RNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDM     71 - 140
KPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS                  141 - 196
//

Text Mined References (20)

PMID Year Title