Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.63
PubTator Score 13.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 3.260 3.9e-08
Atopic dermatitis 1.200 5.5e-05
atypical teratoid/rhabdoid tumor 1.400 4.6e-06
Breast cancer 2.000 2.2e-11
breast carcinoma 1.700 5.0e-36
ductal carcinoma in situ 2.300 2.7e-03
Endometriosis 1.596 1.5e-02
esophageal adenocarcinoma 1.200 2.3e-02
glioblastoma 1.500 4.3e-05
group 3 medulloblastoma 2.200 5.6e-04
intraductal papillary-mucinous carcinoma... 3.000 5.8e-05
intraductal papillary-mucinous neoplasm ... 3.600 2.6e-04
invasive ductal carcinoma 3.100 2.8e-04
lung adenocarcinoma 1.400 6.0e-10
lung cancer 3.600 7.1e-06
malignant mesothelioma 1.700 2.1e-07
medulloblastoma, large-cell 1.400 1.4e-04
nasopharyngeal carcinoma 1.900 2.5e-07
non-small cell lung cancer 3.481 7.9e-31
ovarian cancer 1.600 2.7e-04
pancreatic cancer 1.200 3.3e-02
pancreatic carcinoma 1.200 3.3e-02
pancreatic ductal adenocarcinoma liver m... 1.262 4.0e-02
pediatric high grade glioma 1.300 3.1e-03
pituitary cancer 1.400 6.5e-05
primitive neuroectodermal tumor 1.200 2.3e-03
psoriasis 1.100 1.0e-26

 GO Function (1)

Gene RIF (6)

AA Sequence

MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLL      1 - 70
RNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDM     71 - 140
KPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS                  141 - 196
//

Text Mined References (20)

PMID Year Title