Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.32
PubTator Score 25.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 2.95884362549498E-13
ovarian cancer 8492 2.19770368640779E-6
group 4 medulloblastoma 1875 3.80353191164869E-5
oligodendroglioma 2849 0.00129360049921149
ependymoma 2514 0.00229934868424648
medulloblastoma, large-cell 6234 0.00295168306372085
astrocytic glioma 2241 0.00546946874417386
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00663352506318448
Multiple myeloma 1328 0.00842999302542834
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0103878213604087
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Dyslexia 36 5.26 2.6

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma -1.252 0.008
astrocytic glioma 1.500 0.005
ependymoma 1.600 0.002
oligodendroglioma 1.600 0.001
osteosarcoma -3.400 0.000
group 4 medulloblastoma 1.300 0.000
medulloblastoma, large-cell -1.200 0.003
pancreatic ductal adenocarcinoma liver m... 1.113 0.010
intraductal papillary-mucinous adenoma (... 1.100 0.007
ovarian cancer -1.500 0.000

Synonym

Accession Q14689 A6P4T3 B4E0F0 E7EMA5 Q8IVA3 Q8N4S2 Q8TD89 Q96ML9 DIP2 homolog A
Symbols DIP2
C21orf106

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (2)

PMID Text
20860622 DIP2A could be a cell-surface receptor protein and mediate a FOS down-regulation signal of FRP. FRP bound to DIP2A and CD14, and also with proteins of the TGF-beta superfamily
20054002 These data indicate that DIP2A functions as a novel receptor that mediates the cardiovascular protective effects of FSTL1.

AA Sequence

MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPS      1 - 70
QTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSSVETYTPPDTSSAS     71 - 140
EDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGRPTTAPSAAATPGAAATTALA    141 - 210
GLEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTL    211 - 280
KRPKRPPLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLLATLQRWGTTQPKSP    281 - 350
CLTALDTTGKAVYTLTYGKLWSRSLKLAYTLLNKLTSKNEPLLKPGDRVALVFPNSDPVMFMVAFYGCLL    351 - 420
AELVPVPIEVPLTRKDAGSQQVGFLLGSCGVFLALTTDACQKGLPKAQTGEVAAFKGWPPLSWLVIDGKH    421 - 490
LAKPPKDWHPLAQDTGTGTAYIEYKTSKEGSTVGVTVSHASLLAQCRALTQACGYSEAETLTNVLDFKRD    491 - 560
AGLWHGVLTSVMNRMHVVSVPYALMKANPLSWIQKVCFYKARAALVKSRDMHWSLLAQRGQRDVSLSSLR    561 - 630
MLIVADGANPWSISSCDAFLNVFQSRGLRPEVICPCASSPEALTVAIRRPPDLGGPPPRKAVLSMNGLSY    631 - 700
GVIRVDTEEKLSVLTVQDVGQVMPGANVCVVKLEGTPYLCKTDEVGEICVSSSATGTAYYGLLGITKNVF    701 - 770
EAVPVTTGGAPIFDRPFTRTGLLGFIGPDNLVFIVGKLDGLMVTGVRRHNADDVVATALAVEPMKFVYRG    771 - 840
RIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKAPLGGIHI    841 - 910
SETKQRFLEGTLHPCNVLMCPHTCVTNLPKPRQKQPEVGPASMIVGNLVAGKRIAQASGRELAHLEDSDQ    911 - 980
ARKFLFLADVLQWRAHTTPDHPLFLLLNAKGTVTSTATCVQLHKRAERVAAALMEKGRLSVGDHVALVYP    981 - 1050
PGVDLIAAFYGCLYCGCVPVTVRPPHPQNLGTTLPTVKMIVEVSKSACVLTTQAVTRLLRSKEAAAAVDI   1051 - 1120
RTWPTILDTDDIPKKKIASVFRPPSPDVLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCELYPSRQ   1121 - 1190
IAICLDPYCGLGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAVSQYKARVTFCSYSVMEMCTKGLGA   1191 - 1260
QTGVLRMKGVNLSCVRTCMVVAEERPRIALTQSFSKLFKDLGLPARAVSTTFGCRVNVAICLQGTAGPDP   1261 - 1330
TTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVKVIIAHTETKGPLGDSHLGEIWVSSPHNATGY   1331 - 1400
YTVYGEEALHADHFSARLSFGDTQTIWARTGYLGFLRRTELTDASGGRHDALYVVGSLDETLELRGMRYH   1401 - 1470
PIDIETSVIRAHRSIAECAVFTWTNLLVVVVELDGLEQDALDLVALVTNVVLEEHYLVVGVVVIVDPGVI   1471 - 1540
PINSRGEKQRMHLRDGFLADQLDPIYVAYNM                                          1541 - 1571
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20860622 2010 DIP2 disco-interacting protein 2 homolog A (Drosophila) is a candidate receptor for follistatin-related protein/follistatin-like 1--analysis of their binding with TGF-? superfamily proteins.
20054002 2010 DIP2A functions as a FSTL1 receptor.
17236128 2007 CGG-repeat expansion in the DIP2B gene is associated with the fragile site FRA12A on chromosome 12q13.1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14637006 2003 mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...