Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.47
PubTator Score 5.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma 1.100 0.027
psoriasis -1.100 0.002
osteosarcoma -1.683 0.000
ependymoma 1.100 0.002
sonic hedgehog group medulloblastoma 3.300 0.000
astrocytoma 1.200 0.046
medulloblastoma, large-cell 2.500 0.000
primitive neuroectodermal tumor 1.600 0.006
acute quadriplegic myopathy 1.315 0.000
aldosterone-producing adenoma -1.115 0.045
lung adenocarcinoma 1.046 0.001
lung carcinoma 1.100 0.000
spina bifida -1.569 0.037
Pick disease 1.400 0.000
pituitary cancer -1.100 0.001

Gene RIF (1)

PMID Text
26828271 In this study, we reported that GSE1 is overexpression in breast cancer and silencing of GSE1 significantly suppressed breast cancer cells proliferation, migration and invasion.

AA Sequence

MKGMSHEPKSPSLGMLSTATRTTATVNPLTPSPLNGALVPSGSPATSSALSAQAAPSSSFAAALRKLAKQ      1 - 70
AEEPRGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTKTVNGVWRSES     71 - 140
RQDAGSRSSSGGRERLIVEPPLPQEKAGGPAIPSHLLSTPYPFGLSPSSVVQDSRFPPLNLQRPVHHVVP    141 - 210
PSTVTEDYLRSFRPYHTTDDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAFRMDDSYCLSALRSPF    211 - 280
YPIPTPGSLPPLHPSAMHLHLSGVRYPPELSHSSLAALHSERMSGLSAERLQMDEELRRERERERERERE    281 - 350
READREREKEREREREKEREQEKEREREKERERELERQREQRAREKELLAAKALEPSFLPVAELHGLRGH    351 - 420
ATEERGKPSEQLTPTRAEKLKDAGLQAPKPVQHPLHPVPTPHHTVPSLISNHGIFSLPSSSAATALLIQR    421 - 490
TNEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDMGRPPVPAEAEHRPESTTRPGPNRHEPGGRDP    491 - 560
PQHFGGPPPLISPKPQLHAAPTALWNPVSLMDNTLETRRAESHSLHSHPAAFEPSRQAAVPLVKVERVFC    561 - 630
PEKAEEGPRKREPAPLDKYQPPPPPPREGGSLEHQPFLPGPGPFLAELEKSTQTILGQQRASLPQAATFG    631 - 700
ELSGPLKPGSPYRPPVPRAPDPAYIYDEFLQQRRRLVSKLDLEERRRREAQEKGYYYDLDDSYDESDEEE    701 - 770
VRAHLRCVAEQPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPTIQSKRQTPS    771 - 840
PRLALSTRYSPDEMNNSPNFEEKKKFLTIFNLTHISAEKRKDKERLVEMLRAMKQKALSAAVADSLTNSP    841 - 910
RDSPAVSLSEPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAP    911 - 980
GGKKSLSMLHYIRGAAPKDIPVPLSHSTNGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHKGSVAVLS    981 - 1050
AEQNHKVDTSVHYNIPELQSSSRAPPPQHNGQQEPPTARKGPPTQELDRDSEEEEEEDDEDGEDEEEVPK   1051 - 1120
RKWQGIEAVFEAYQEHIEEQNLERQVLQTQCRRLEARHYSLSLTAEQLSHSVAELRSQKQKMVSERERLQ   1121 - 1190
AELDHLRKCLALPAMHWPRGYLKGYPR                                              1191 - 1217
//

Text Mined References (24)

PMID Year Title
26828271 2016 GSE1 negative regulation by miR-489-5p promotes breast cancer cell proliferation and invasion.
25416956 2014 A proteome-scale map of the human interactome network.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...