Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.47
PubTator Score 5.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.34266799868892E-15
sonic hedgehog group medulloblastoma 1482 1.93598182128775E-7
Pick disease 1893 8.67249702656698E-6
osteosarcoma 7933 1.41815124664045E-5
medulloblastoma, large-cell 6234 4.93479308158497E-5
acute quadriplegic myopathy 1157 2.09866863456934E-4
lung adenocarcinoma 2714 6.20400206142822E-4
pituitary cancer 1972 9.92044440886475E-4
psoriasis 6685 0.00162199559477951
ependymoma 2514 0.0017225527045693
primitive neuroectodermal tumor 3031 0.00600816093983788
oligodendroglioma 2849 0.0270798604832415
spina bifida 1064 0.0373599302586899
aldosterone-producing adenoma 664 0.0448586456490037
astrocytoma 1493 0.0464063924122334
Disease Target Count Z-score Confidence
Medulloepithelioma 1 3.802 1.9

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma 1.100 0.027
psoriasis -1.100 0.002
osteosarcoma -1.683 0.000
ependymoma 1.100 0.002
sonic hedgehog group medulloblastoma 3.300 0.000
astrocytoma 1.200 0.046
medulloblastoma, large-cell 2.500 0.000
primitive neuroectodermal tumor 1.600 0.006
acute quadriplegic myopathy 1.315 0.000
aldosterone-producing adenoma -1.115 0.045
lung adenocarcinoma 1.046 0.001
lung carcinoma 1.100 0.000
spina bifida -1.569 0.037
Pick disease 1.400 0.000
pituitary cancer -1.100 0.001

Synonym

Accession Q14687 D3DUM4 Q8IY61 Q96GA4 Q9BW09
Symbols CRHSP24
KIAA0182

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 Compartment GO Term (2)

Pathway (1)

Gene RIF (1)

PMID Text
26828271 In this study, we reported that GSE1 is overexpression in breast cancer and silencing of GSE1 significantly suppressed breast cancer cells proliferation, migration and invasion.

AA Sequence

MKGMSHEPKSPSLGMLSTATRTTATVNPLTPSPLNGALVPSGSPATSSALSAQAAPSSSFAAALRKLAKQ      1 - 70
AEEPRGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTKTVNGVWRSES     71 - 140
RQDAGSRSSSGGRERLIVEPPLPQEKAGGPAIPSHLLSTPYPFGLSPSSVVQDSRFPPLNLQRPVHHVVP    141 - 210
PSTVTEDYLRSFRPYHTTDDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAFRMDDSYCLSALRSPF    211 - 280
YPIPTPGSLPPLHPSAMHLHLSGVRYPPELSHSSLAALHSERMSGLSAERLQMDEELRRERERERERERE    281 - 350
READREREKEREREREKEREQEKEREREKERERELERQREQRAREKELLAAKALEPSFLPVAELHGLRGH    351 - 420
ATEERGKPSEQLTPTRAEKLKDAGLQAPKPVQHPLHPVPTPHHTVPSLISNHGIFSLPSSSAATALLIQR    421 - 490
TNEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDMGRPPVPAEAEHRPESTTRPGPNRHEPGGRDP    491 - 560
PQHFGGPPPLISPKPQLHAAPTALWNPVSLMDNTLETRRAESHSLHSHPAAFEPSRQAAVPLVKVERVFC    561 - 630
PEKAEEGPRKREPAPLDKYQPPPPPPREGGSLEHQPFLPGPGPFLAELEKSTQTILGQQRASLPQAATFG    631 - 700
ELSGPLKPGSPYRPPVPRAPDPAYIYDEFLQQRRRLVSKLDLEERRRREAQEKGYYYDLDDSYDESDEEE    701 - 770
VRAHLRCVAEQPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPTIQSKRQTPS    771 - 840
PRLALSTRYSPDEMNNSPNFEEKKKFLTIFNLTHISAEKRKDKERLVEMLRAMKQKALSAAVADSLTNSP    841 - 910
RDSPAVSLSEPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAP    911 - 980
GGKKSLSMLHYIRGAAPKDIPVPLSHSTNGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHKGSVAVLS    981 - 1050
AEQNHKVDTSVHYNIPELQSSSRAPPPQHNGQQEPPTARKGPPTQELDRDSEEEEEEDDEDGEDEEEVPK   1051 - 1120
RKWQGIEAVFEAYQEHIEEQNLERQVLQTQCRRLEARHYSLSLTAEQLSHSVAELRSQKQKMVSERERLQ   1121 - 1190
AELDHLRKCLALPAMHWPRGYLKGYPR                                              1191 - 1217
//

Text Mined References (24)

PMID Year Title
26828271 2016 GSE1 negative regulation by miR-489-5p promotes breast cancer cell proliferation and invasion.
25416956 2014 A proteome-scale map of the human interactome network.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...