Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.18
PubTator Score 5.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.315 2.1e-04
aldosterone-producing adenoma -1.115 4.5e-02
astrocytoma 1.200 4.6e-02
ependymoma 1.100 1.7e-03
group 3 medulloblastoma 2.300 2.0e-05
lung adenocarcinoma 1.046 6.2e-04
lung carcinoma 1.100 1.3e-15
medulloblastoma, large-cell 1.600 1.0e-03
oligodendroglioma 1.100 2.7e-02
osteosarcoma -1.683 1.4e-05
Pick disease 1.400 8.7e-06
pituitary cancer -1.100 9.9e-04
primitive neuroectodermal tumor 1.600 6.0e-03
psoriasis -1.100 1.6e-03
spina bifida -1.569 3.7e-02

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MKGMSHEPKSPSLGMLSTATRTTATVNPLTPSPLNGALVPSGSPATSSALSAQAAPSSSFAAALRKLAKQ      1 - 70
AEEPRGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTKTVNGVWRSES     71 - 140
RQDAGSRSSSGGRERLIVEPPLPQEKAGGPAIPSHLLSTPYPFGLSPSSVVQDSRFPPLNLQRPVHHVVP    141 - 210
PSTVTEDYLRSFRPYHTTDDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAFRMDDSYCLSALRSPF    211 - 280
YPIPTPGSLPPLHPSAMHLHLSGVRYPPELSHSSLAALHSERMSGLSAERLQMDEELRRERERERERERE    281 - 350
READREREKEREREREKEREQEKEREREKERERELERQREQRAREKELLAAKALEPSFLPVAELHGLRGH    351 - 420
ATEERGKPSEQLTPTRAEKLKDAGLQAPKPVQHPLHPVPTPHHTVPSLISNHGIFSLPSSSAATALLIQR    421 - 490
TNEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDMGRPPVPAEAEHRPESTTRPGPNRHEPGGRDP    491 - 560
PQHFGGPPPLISPKPQLHAAPTALWNPVSLMDNTLETRRAESHSLHSHPAAFEPSRQAAVPLVKVERVFC    561 - 630
PEKAEEGPRKREPAPLDKYQPPPPPPREGGSLEHQPFLPGPGPFLAELEKSTQTILGQQRASLPQAATFG    631 - 700
ELSGPLKPGSPYRPPVPRAPDPAYIYDEFLQQRRRLVSKLDLEERRRREAQEKGYYYDLDDSYDESDEEE    701 - 770
VRAHLRCVAEQPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPTIQSKRQTPS    771 - 840
PRLALSTRYSPDEMNNSPNFEEKKKFLTIFNLTHISAEKRKDKERLVEMLRAMKQKALSAAVADSLTNSP    841 - 910
RDSPAVSLSEPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAP    911 - 980
GGKKSLSMLHYIRGAAPKDIPVPLSHSTNGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHKGSVAVLS    981 - 1050
AEQNHKVDTSVHYNIPELQSSSRAPPPQHNGQQEPPTARKGPPTQELDRDSEEEEEEDDEDGEDEEEVPK   1051 - 1120
RKWQGIEAVFEAYQEHIEEQNLERQVLQTQCRRLEARHYSLSLTAEQLSHSVAELRSQKQKMVSERERLQ   1121 - 1190
AELDHLRKCLALPAMHWPRGYLKGYPR                                              1191 - 1217
//

Text Mined References (24)

PMID Year Title