Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.15
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.4e-08
subependymal giant cell astrocytoma 2287 7.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.300 2.4e-08
subependymal giant cell astrocytoma -1.071 7.1e-03

Gene RIF (1)

AA Sequence

MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPRPAGPTPRGHGRPAAAVAQPLEPGPGPPERAGGGGA      1 - 70
ARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPILNYLRHGKL     71 - 140
IITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKF    141 - 210
EQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSEKAKILQERGSRM                     211 - 263
//

Text Mined References (11)

PMID Year Title