Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.62
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
subependymal giant cell astrocytoma -1.071 0.007
ovarian cancer -1.300 0.000

Gene RIF (1)

PMID Text
23857120 By merging results of a meta-GWAS, results in the CHARGE consortium data sets and an in vivo genotyping comprising 4501 individuals, detected a novel locus ATP5H/KCTD2 associated with Alzheimer's disease risk

AA Sequence

MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPRPAGPTPRGHGRPAAAVAQPLEPGPGPPERAGGGGA      1 - 70
ARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPILNYLRHGKL     71 - 140
IITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKF    141 - 210
EQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSEKAKILQERGSRM                     211 - 263
//

Text Mined References (11)

PMID Year Title
23857120 2014 ATP5H/KCTD2 locus is associated with Alzheimer's disease risk.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12620391 2003 Radiation hybrid map, physical map, and low-pass genomic sequence of the canine prcd region on CFA9 and comparative mapping with the syntenic region on human chromosome 17.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.
More...