Property Summary

NCBI Gene PubMed Count 36
PubMed Score 36.61
PubTator Score 22.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 385 0.0 0.7
Multiple Sclerosis 540 0.0 1.5
Disease Target Count
Spastic Quadriplegia 42

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.088 2.1e-03
Amyotrophic lateral sclerosis 1.161 6.4e-05
astrocytoma 1.600 1.6e-02
Astrocytoma, Pilocytic 1.800 2.1e-07
autosomal dominant Emery-Dreifuss muscul... 1.325 4.2e-03
Breast cancer -1.200 1.6e-04
breast carcinoma -1.600 1.7e-04
Common variable immunodeficiency -1.709 4.5e-03
dermatomyositis 1.600 3.2e-04
Down syndrome 1.600 7.4e-04
ductal carcinoma in situ -2.300 1.3e-04
esophageal adenocarcinoma -2.000 1.8e-02
fascioscapulohumeral muscular dystrophy 1.094 2.7e-04
fibroadenoma -1.400 2.8e-02
gastric cancer 1.800 8.8e-04
hepatocellular carcinoma 1.200 1.3e-04
interstitial cystitis -1.500 3.9e-04
intraductal papillary-mucinous neoplasm ... -1.300 1.7e-02
invasive ductal carcinoma -2.300 9.3e-03
lung adenocarcinoma -1.300 2.8e-10
lung carcinoma -1.200 1.0e-17
malignant mesothelioma -3.800 5.5e-09
oligodendroglioma 1.700 2.5e-02
ovarian cancer -1.800 7.7e-05
pancreatic cancer 1.400 7.5e-03
pancreatic carcinoma 1.400 7.5e-03
pancreatic ductal adenocarcinoma liver m... -1.363 2.7e-02
sonic hedgehog group medulloblastoma -1.600 6.9e-03
tuberculosis -3.400 5.7e-05

 GO Function (1)

Gene RIF (19)

AA Sequence

MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKRLNIQKRRKPS      1 - 70
VPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISKPPPPLETSLPFLTIPENRQL     71 - 140
PPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKH    141 - 210
QLQNGYQGNGDYGSYAPAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQ    211 - 280
VRTIPVLQVKISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYE    281 - 350
EEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSR    351 - 420
SCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQ    421 - 490
ELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVV    491 - 560
GPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVCETGSNTEESVNDLTLLKTNLNLKEVRSIGC    561 - 630
GDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCL    631 - 700
STLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNY    701 - 770
LVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTL    771 - 840
LAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCG    841 - 910
GLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKK    911 - 980
KDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGH    981 - 1050
HAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQH   1051 - 1120
EWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVD   1121 - 1190
HQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADV   1191 - 1260
NIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQ   1261 - 1330
SPGTPRLGRKTSPGPTHRGSFD                                                   1331 - 1352
//

Text Mined References (43)

PMID Year Title