Property Summary

NCBI Gene PubMed Count 33
Grant Count 1
Funding $138,191
PubMed Score 29.37
PubTator Score 22.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14678 A2A2W8 D3DRH3 Q5W0W0 Q8IY65 Q8WX74
Symbols KANK
CPSQ2
ANKRD15

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (16)

PMID Text
25973051 primary results revealed new function of Kank1 for nasopharyngeal cancer
25961457 identified recessive mutations in kidney ankyrin repeat-containing protein 1 (KANK1), KANK2, and KANK4 in individuals with nephrotic syndrome.
25187374 Follow-up replication analyses in up to an additional 21,345 participants identified three new fasting plasma glucose loci reaching genome-wide significance in or near PDK1-RAPGEF4, KANK1, and IGF1R.
24399197 Thus, the human brain glioma apoptosis induced by upregulation of the Kank1 gene is closely relevant to the mitochondrial pathway.
23454270 Our case suggests that KANK1 may be subject to random monoallelic expression as a possible mode of inheritance.
22876580 ANKRD15 encodes the kidney ankyrin repeat-containing protein.
22084092 BIG1 and KANK1 play roles in regulating cell polarity during directed migration in wound healing.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20164854 KANK1, a candidate tumor suppressor gene, is fused to PDGFRB in an imatinib-responsive myeloid neoplasm with severe thrombocythemia.
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKRLNIQKRRKPS      1 - 70
VPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISKPPPPLETSLPFLTIPENRQL     71 - 140
PPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKH    141 - 210
QLQNGYQGNGDYGSYAPAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQ    211 - 280
VRTIPVLQVKISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYE    281 - 350
EEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSR    351 - 420
SCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQ    421 - 490
ELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVV    491 - 560
GPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVCETGSNTEESVNDLTLLKTNLNLKEVRSIGC    561 - 630
GDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCL    631 - 700
STLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNY    701 - 770
LVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTL    771 - 840
LAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCG    841 - 910
GLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKK    911 - 980
KDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGH    981 - 1050
HAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQH   1051 - 1120
EWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVD   1121 - 1190
HQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADV   1191 - 1260
NIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQ   1261 - 1330
SPGTPRLGRKTSPGPTHRGSFD                                                   1331 - 1352
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25973051 2015 Kank1 reexpression induced by 5-Aza-2'-deoxycytidine suppresses nasopharyngeal carcinoma cell proliferation and promotes apoptosis.
25961457 2015 KANK deficiency leads to podocyte dysfunction and nephrotic syndrome.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
24399197 2014 Upregulation of the Kank1 gene-induced brain glioma apoptosis and blockade of the cell cycle in G0/G1 phase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23454270 2013 Familial KANK1 deletion that does not follow expected imprinting pattern.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22876580 2012 Pure distal 9p deletion in a female infant with cerebral palsy.
More...