Property Summary

NCBI Gene PubMed Count 31
PubMed Score 172.91
PubTator Score 44.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
osteosarcoma 7933 9.30055423435769E-7
Breast cancer 3099 1.44454757721227E-6
lung adenocarcinoma 2714 3.85790016820573E-6
atypical teratoid / rhabdoid tumor 4369 1.78604117755313E-5
psoriasis 6685 3.42604835720257E-5
medulloblastoma, large-cell 6234 5.4252063724767E-4
adult high grade glioma 2148 5.71792986247138E-4
ependymoma 2514 0.00126740783505518
ovarian cancer 8492 0.00326898208584961
glioblastoma 5572 0.00410630604285744
Waldenstrons macroglobulinemia 765 0.00506902645270846
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00709966092184954
Multiple myeloma 1328 0.0110607889243902
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0341147355544744
cystic fibrosis and chronic rhinosinusitis 213 0.0411850166513883
Disease Target Count Z-score Confidence
Xanthinuria 8 3.822 1.9

Expression

Synonym

Accession Q14677 B7Z6F8 D3DQJ6 Q8NAF1 Q96E05
Symbols ENTH
EPN4
EPNR
CLINT

Gene

PDB

1XGW   2QY7   2V8S  

  Ortholog (9)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (17)

PMID Text
26179914 Although epsinR has been shown to be a cargo adaptor, the present study indicates that it is an order of magnitude more abundant in CCVs than its known cargo protein, vti1b, suggesting that it may have other functions as well.
25496667 Genome-wide shRNA screening identifies CLINT1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21116212 These results do not support a significant role of GRIA1 or CLINT1 in the development of schizophrenia in the German population.
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18929466 Variation in the Epsin 4 gene is significantly associated with psychotic disorder in this Latino population
18929466 Observational study of gene-disease association. (HuGE Navigator)
18696005 Our results suggest that the examined region of Epsin 4 does not have a major influence on susceptibility to schizophrenia in Japanese.
18696005 Observational study of gene-disease association. (HuGE Navigator)
18033301 characterization of the molecular details governing the sorting of a SNARE into clathrin-coated vesicles, namely the direct recognition of the three-helical bundle H(abc) domain of the mouse SNARE Vti1b by the human clathrin adaptor epsinR
More...

AA Sequence

MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLK      1 - 70
DNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQ     71 - 140
DDDRLREERKKAKKNKDKYVGVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGS    141 - 210
TIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRTAN    211 - 280
PSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADF    281 - 350
GSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNS    351 - 420
SDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLL    421 - 490
PGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGT    491 - 560
MGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK         561 - 625
//

Text Mined References (43)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26179914 2015 Contributions of epsinR and gadkin to clathrin-mediated intracellular trafficking.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21116212 2011 Association study of the GRIA1 and CLINT1 (Epsin 4) genes in a German schizophrenia sample.
20562859 2010 Network organization of the human autophagy system.
More...