Property Summary

NCBI Gene PubMed Count 99
Grant Count 98
R01 Count 66
Funding $9,074,980.47
PubMed Score 129.17
PubTator Score 134.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.109 0.002
malignant mesothelioma 1.700 0.000
psoriasis -2.300 0.000
osteosarcoma -2.646 0.000
group 3 medulloblastoma 2.100 0.000
astrocytoma 1.100 0.024
primitive neuroectodermal tumor 1.100 0.000
gastric carcinoma 1.100 0.018
ovarian cancer 1.400 0.000
dermatomyositis 1.100 0.001

Gene

PDB

3UEO   2AZM   2ADO   2ETX   3K05   3UMZ   3UN0   3UNM   3UNN   3UOT  

Gene RIF (79)

PMID Text
26845027 MDC1 recruits TNKS1 and TNKS2 to DNA lesions.
26734725 The interaction of MDC1 with RNF8, but not with ATM requires WRAP53beta, suggesting that WRAP53beta facilitates the former interaction without altering phosphorylation of MDC1 by ATM.
26247734 MDC1 silencing enhances the radiosensitivity of human nasopharyngeal cancer CNE1 cells and results in xenograft tumor growth inhibition.
25976740 we generated two HEP-2 cell lines with a stable knockdown of MDC1 or 53BP1 with short hairpin RNA (shRNA), respectively, and investigated the effect of MDC1 and 53BP1 on cell radiosensitivity
25934801 The study suggest that MDC1 as an epigenetic modifier regulates androgen receptor transcriptional activity and MDC1 may function as a tumor suppressor of prostate cancer.
25627978 During replicative senescence and stress-induced premature senescence, MDC1 is downregulated by upregulating miR-22.
25592380 our findings suggest that MDC1 promotes ovarian cancer metastasis through the induction of EMT.
25514464 we have identified a novel antisense lncRNA MDC1-AS, which may participate in bladder cancer through up-regulation of its antisense tumor-suppressing gene MDC1
25198518 data suggested that the SNP rs4713354A>C of MDC1 may be a functional genetic biomarker for susceptibility to lung cancer in Chinese
24509855 ATM and MDC1 maintain genomic stability not only by controlling the DNA damage response, but also by regulating spindle assembly checkpoint activation, providing an important link between these two essential biological processes.
More...

AA Sequence

MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPS      1 - 70
ISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLPFV     71 - 140
SRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRMVKKSRTTSSSVIVPESDEEGHSPVLGGLGP    141 - 210
PFAFNLNSDTDVEEGQQPATEEASSAARRGATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGN    211 - 280
GVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKR    281 - 350
KIFHGVGTRGPGAPGLAHLQESQAGSDTDVEEGKAPQAVPLEKSQASMVINSDTDDEEEVSAALTLAHLK    351 - 420
ESQPAIWNRDAEEDMPQRVVLLQRSQTTTERDSDTDVEEEELPVENREAVLKDHTKIRALVRAHSEKDQP    421 - 490
PFGDSDDSVEADKSSPGIHLERSQASTTVDINTQVEKEVPPGSAIIHIKKHQVSVEGTNQTDVKAVGGPA    491 - 560
KLLVVSLEEAWPLHGDCETDAEEGTSLTASVVADVRKSQLPAEGDAGAEWAAAVLKQERAHEVGAQGGPP    561 - 630
VAQVEQDLPISRENLTDLVVDTDTLGESTQPQREGAQVPTGREREQHVGGTKDSEDNYGDSEDLDLQATQ    631 - 700
CFLENQGLEAVQSMEDEPTQAFMLTPPQELGPSHCSFQTTGTLDEPWEVLATQPFCLRESEDSETQPFDT    701 - 770
HLEAYGPCLSPPRAIPGDQHPESPVHTEPMGIQGRGRQTVDKVMGIPKETAERVGPERGPLERETEKLLP    771 - 840
ERQTDVTGEEELTKGKQDREQKQLLARDTQRQESDKNGESASPERDRESLKVEIETSEEIQEKQVQKQTL    841 - 910
PSKAFEREVERPVANRECDPAELEEKVPKVILERDTQRGEPEGGSQDQKGQASSPTPEPGVGAGDLPGPT    911 - 980
SAPVPSGSQSGGRGSPVSPRRHQKGLLNCKMPPAEKASRIRAAEKVSRGDQESPDACLPPTVPEAPAPPQ    981 - 1050
KPLNSQSQKHLAPPPLLSPLLPSIKPTVRKTRQDGSQEAPEAPLSSELEPFHPKPKIRTRKSSRMTPFPA   1051 - 1120
TSAAPEPHPSTSTAQPVTPKPTSQATRSRTNRSSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTRGR   1121 - 1190
KSRSSVKTPETVVPTALELQPSTSTDRPVTSEPTSQATRGRKNRSSVKTPEPVVPTAPELQPSTSTDQPV   1191 - 1260
TSEPTYQATRGRKNRSSVKTPEPVVPTAPELRPSTSTDRPVTPKPTSRTTRSRTNMSSVKTPETVVPTAP   1261 - 1330
ELQISTSTDQPVTPKPTSRTTRSRTNMSSVKNPESTVPIAPELPPSTSTEQPVTPEPTSRATRGRKNRSS   1331 - 1400
GKTPETLVPTAPKLEPSTSTDQPVTPEPTSQATRGRTNRSSVKTPETVVPTAPELQPSTSTDQPVTPEPT   1401 - 1470
SQATRGRTDRSSVKTPETVVPTAPELQASASTDQPVTSEPTSRTTRGRKNRSSVKTPETVVPAAPELQPS   1471 - 1540
TSTDQPVTPEPTSRATRGRTNRSSVKTPESIVPIAPELQPSTSRNQLVTPEPTSRATRCRTNRSSVKTPE   1541 - 1610
PVVPTAPEPHPTTSTDQPVTPKLTSRATRRKTNRSSVKTPKPVEPAASDLEPFTPTDQSVTPEAIAQGGQ   1611 - 1680
SKTLRSSTVRAMPVPTTPEFQSPVTTDQPISPEPITQPSCIKRQRAAGNPGSLAAPIDHKPCSAPLEPKS   1681 - 1750
QASRNQRWGAVRAAESLTAIPEPASPQLLETPIHASQIQKVEPAGRSRFTPELQPKASQSRKRSLATMDS   1751 - 1820
PPHQKQPQRGEVSQKTVIIKEEEEDTAEKPGKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQES   1821 - 1890
TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAG   1891 - 1960
FFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMP   1961 - 2030
RSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLEMSST              2031 - 2089
//

Text Mined References (119)

PMID Year Title
26845027 2016 Tankyrases Promote Homologous Recombination and Check Point Activation in Response to DSBs.
26734725 2015 The proximity ligation assay reveals that at DNA double-strand breaks WRAP53? associates with ?H2AX and controls interactions between RNF8 and MDC1.
26247734 2015 Silencing NFBD1/MDC1 enhances the radiosensitivity of human nasopharyngeal cancer CNE1 cells and results in tumor growth inhibition.
25976740 2015 Downregulation of MDC1 and 53BP1 by short hairpin RNA enhances radiosensitivity in laryngeal carcinoma cells.
25934801 2015 MDC1 functionally identified as an androgen receptor co-activator participates in suppression of prostate cancer.
25627978 2015 MicroRNA-22 Suppresses DNA Repair and Promotes Genomic Instability through Targeting of MDC1.
25592380 2015 MDC1 promotes ovarian cancer metastasis by inducing epithelial-mesenchymal transition.
25514464 2015 A novel antisense long noncoding RNA regulates the expression of MDC1 in bladder cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25198518 2014 A Newfound association between MDC1 functional polymorphism and lung cancer risk in Chinese.
More...