Property Summary

NCBI Gene PubMed Count 38
Grant Count 405
R01 Count 72
Funding $83,489,926.62
PubMed Score 261.38
PubTator Score 120.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14674
Symbols ESP1
SEPA

Gene

PANTHER Protein Class (1)

Gene RIF (29)

PMID Text
26267133 The assay was used to quantify Separase proteolytic activity in leukemic cell lines and peripheral blood samples from leukemia patients.
26087013 Separase protein levels decrease and Separase proteolytic activity increases exclusively in b3a2 p210BCR-ABL-positive cell lines under Imatinib treatment.
25921067 Data indicate that separase is subject to native-state cis/trans isomerization by peptidyl-prolyl-isomerase Pin1.
25299182 Recruitment and activation of separase at centrosomes are two distinct steps that do not require microtubules.
25086634 High ESPL1 mRNA expression was associated with luminal B breast cancers.
24792645 Separase is an oncogene whose overexpression induces tumorigenesis, and indicate that Separase overexpression and aberrant nuclear localization are common in many tumor types and may predict outcome in some human malignancies.
23798554 Mutation of the homologous position in PTTG1 (H(134)) switched PTTG1 from an inhibitor into an activator of ESP1.
22814604 By consecutively acting as a protease and a cdk1 inhibitor, separase coordinates two key processes to achieve simultaneous and abrupt separation of sister chromatids.
22542101 Kendrin is a novel and crucial substrate for separase (ESPL1) at the centrosome, protecting the engaged centrioles from premature disengagement and thereby blocking reduplication until the cell passes through mitosis.
21272169 Results identify a new functional role of securin and separase in the modulation of membrane traffic and protein secretion that implicates regulation of V-ATPase assembly and function.
More...

AA Sequence

MRSFKRVNFGTLLSSQKEAEELLPALKEFLSNPPAGFPSSRSDAERRQACDAILRACNQQLTAKLACPRH      1 - 70
LGSLLELAELACDGYLVSTPQRPPLYLERILFVLLRNAAAQGSPEATLRLAQPLHACLVQCSREAAPQDY     71 - 140
EAVARGSFSLLWKGAEALLERRAAFAARLKALSFLVLLEDESTPCEVPHFASPTACRAVAAHQLFDASGH    141 - 210
GLNEADADFLDDLLSRHVIRALVGERGSSSGLLSPQRALCLLELTLEHCRRFCWSRHHDKAISAVEKAHS    211 - 280
YLRNTNLAPSLQLCQLGVKLLQVGEEGPQAVAKLLIKASAVLSKSMEAPSPPLRALYESCQFFLSGLERG    281 - 350
TKRRYRLDAILSLFAFLGGYCSLLQQLRDDGVYGGSSKQQQSFLQMYFQGLHLYTVVVYDFAQGCQIVDL    351 - 420
ADLTQLVDSCKSTVVWMLEALEGLSGQELTDHMGMTASYTSNLAYSFYSHKLYAEACAISEPLCQHLGLV    421 - 490
KPGTYPEVPPEKLHRCFRLQVESLKKLGKQAQGCKMVILWLAALQPCSPEHMAEPVTFWVRVKMDAARAG    491 - 560
DKELQLKTLRDSLSGWDPETLALLLREELQAYKAVRADTGQERFNIICDLLELSPEETPAGAWARATHLV    561 - 630
ELAQVLCYHDFTQQTNCSALDAIREALQLLDSVRPEAQARDQLLDDKAQALLWLYICTLEAKMQEGIERD    631 - 700
RRAQAPGNLEEFEVNDLNYEDKLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKELLTKGQAPAVRCLQ    701 - 770
QTAASLQILAALYQLVAKPMQALEVLLLLRIVSERLKDHSKAAGSSCHITQLLLTLGCPSYAQLHLEEAA    771 - 840
SSLKHLDQTTDTYLLLSLTCDLLRSQLYWTHQKVTKGVSLLLSVLRDPALQKSSKAWYLLRVQVLQLVAA    841 - 910
YLSLPSNNLSHSLWEQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDILSTQKAAVETSFLDYGENLVQK    911 - 980
WQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTKLQIPRQCALFLVLKGELELARNDIDLCQSD    981 - 1050
LQQVLFLLESCTEFGGVTQHLDSVKKVHLQKGKQQAQVPCPPQLPEEELFLRGPALELVATVAKEPGPIA   1051 - 1120
PSTNSSPVLKTKPQPIPNFLSHSPTCDCSLCASPVLTAVCLRWVLVTAGVRLAMGHQAQGLDLLQVVLKG   1121 - 1190
CPEAAERLTQALQASLNHKTPPSLVPSLLDEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPH   1191 - 1260
LEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGRQKLASAPLRL   1261 - 1330
NNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQAPRVQQRVQTRLKVNFSDDSD   1331 - 1400
LEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVVAPGSAPGNPGLNGRSRRAKKVASRHCEERR   1401 - 1470
PQRASDQARPGPEIMRTIPEEELTDNWRKMSFEILRGSDGEDSASGGKTPAPGPEAASGEWELLRLDSSK   1471 - 1540
KKLPSPCPDKESDKDLGPRLRLPSAPVATGLSTLDSICDSLSVAFRGISHCPPSGLYAHLCRFLALCLGH   1541 - 1610
RDPYATAFLVTESVSITCRHQLLTHLHRQLSKAQKHRGSLEIADQLQGLSLQEMPGDVPLARIQRLFSFR   1611 - 1680
ALESGHFPQPEKESFQERLALIPSGVTVCVLALATLQPGTVGNTLLLTRLEKDSPPVSVQIPTGQNKLHL   1681 - 1750
RSVLNEFDAIQKAQKENSSCTDKREWWTGRLALDHRMEVLIASLEKSVLGCWKGLLLPSSEEPGPAQEAS   1751 - 1820
RLQELLQDCGWKYPDRTLLKIMLSGAGALTPQDIQALAYGLCPTQPERAQELLNEAVGRLQGLTVPSNSH   1821 - 1890
LVLVLDKDLQKLPWESMPSLQALPVTRLPSFRFLLSYSIIKEYGASPVLSQGVDPRSTFYVLNPHNNLSS   1891 - 1960
TEEQFRANFSSEAGWRGVVGEVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCS   1961 - 2030
SAALAVRGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVNQARQAP   2031 - 2100
RLKYLIGAAPIAYGLPVSLR                                                     2101 - 2120
//

Text Mined References (45)

PMID Year Title
26267133 2015 Measurement of separase proteolytic activity in single living cells by a fluorogenic flow cytometry assay.
26087013 2015 Clonal Evolution and Blast Crisis Correlate with Enhanced Proteolytic Activity of Separase in BCR-ABL b3a2 Fusion Type CML under Imatinib Therapy.
25921067 2015 Human chromosome segregation involves multi-layered regulation of separase by the peptidyl-prolyl-isomerase Pin1.
25299182 2014 Sensors at centrosomes reveal determinants of local separase activity.
25086634 2014 ESPL1 is a candidate oncogene of luminal B breast cancers.
24792645 2014 Overexpression and constitutive nuclear localization of cohesin protease Separase protein correlates with high incidence of relapse and reduced overall survival in glioblastoma multiforme.
23798554 2013 Critical differences between isoforms of securin reveal mechanisms of separase regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814604 2012 Separase sensor reveals dual roles for separase coordinating cohesin cleavage and cdk1 inhibition.
22542101 2012 Kendrin is a novel substrate for separase involved in the licensing of centriole duplication.
More...