Property Summary

NCBI Gene PubMed Count 39
Grant Count 7
Funding $270,649.08
PubMed Score 20.68
PubTator Score 26.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.340 0.001
osteosarcoma 2.065 0.000
lung adenocarcinoma 1.476 0.000
ovarian cancer 1.400 0.000

Gene RIF (13)

PMID Text
26724866 Identification of NORAD-interacting proteins revealed that this lncRNA functions as a multivalent binding platform for PUM proteins, with the capacity to sequester a significant fraction of the total cellular pool of PUM1 and PUM2.Studies reveal unanticipated roles for a lncRNA and PUMILIO proteins in the maintenance of genomic stability.
26517885 Pumilios (including PUM1 and PUM2) are RNA-binding proteins with Puf domains made up of 8 poorly conserved Puf repeats, 3 helix bundles arranged in rainbow architecture, where each repeat recognizes a single base of the RNA-binding sequence. [REVIEW]
25512524 PUM repeats have now been identified in proteins that function in pre-rRNA processing, including human Puf-A and yeast Puf6.
23625657 The promoting effect of hPuf-A in tumorigenesis might be correlated with the regulation of its associated mRNAs.
22916034 MED15 and PUM1 proteins with coiled-coil domains are potent enhancers of polyQ-mediated ataxin-1 protein misfolding and proteotoxicity in vitro and in vivo.
22345517 human Pumilio homologs Pum 1 and Pum 2 repress the translation of E2F3 by binding to the E2F3 3' untranslated region (UTR) and also enhance the activity of multiple E2F3 targeting microRNAs (miRNAs)
21397187 Three distinct modes of target RNA binding by PUM1 around the fifth mRNA base were observed.
20818387 Pumilio-1 (PUM1) is a ubiquitously expressed RBP that was shown to interact with p27-3' UTR.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19319195 Puf-A transcripts were uniformly distributed in early embryos, but became restricted primarily to eyes and ovaries at a later stage of development
More...

AA Sequence

MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIG      1 - 70
VAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGR     71 - 140
AMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSEVNSVLSP    141 - 210
RSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTN    211 - 280
GLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPM    281 - 350
EHVGMEPLQFDYSGTQVPVDSAAATVGLFDYNSQQQLFQRPNALAVQQLTAAQQQQYALAAAHQPHIGLA    351 - 420
PAAFVPNPYIISAAPPGTDPYTAGLAAAATLGPAVVPHQYYGVTPWGVYPASLFQQQAAAAAAATNSANQ    421 - 490
QTTPQAQQGQQQVLRGGASQRPLTPNQNQQGQQTDPLVAAAAVNSALAFGQGLAAGMPGYPVLAPAAYYD    491 - 560
QTGALVVNAGARNGLGAPVRLVAPAPVIISSSAAQAAVAAAAASANGAAGGLAGTTNGPFRPLGTQQPQP    561 - 630
QPQQQPNNNLASSSFYGNNSLNSNSQSSSLFSQGSAQPANTSLGFGSSSSLGATLGSALGGFGTAVANSN    631 - 700
TGSGSRRDSLTGSSDLYKRTSSSLTPIGHSFYNGLSFSSSPGPVGMPLPSQGPGHSQTPPPSLSSHGSSS    701 - 770
SLNLGGLTNGSGRYISAAPGAEAKYRSASSASSLFSPSSTLFSSSRLRYGMSDVMPSGRSRLLEDFRNNR    771 - 840
YPNLQLREIAGHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGS    841 - 910
LEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGHVLKCVKDQNGNHVVQKCIEC    911 - 980
VQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVL    981 - 1050
EHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQY   1051 - 1120
ANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAKLEKYYMKNGVDLGPICGPPNGII       1121 - 1186
//

Text Mined References (52)

PMID Year Title
26724866 2016 Noncoding RNA NORAD Regulates Genomic Stability by Sequestering PUMILIO Proteins.
26517885 2015 Bespoke RNA recognition by Pumilios.
25768905 2015 Pumilio1 haploinsufficiency leads to SCA1-like neurodegeneration by increasing wild-type Ataxin1 levels.
25512524 2014 A divergent Pumilio repeat protein family for pre-rRNA processing and mRNA localization.
25340845 2014 A novel function of human Pumilio proteins in cytoplasmic sensing of viral infection.
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23625657 2013 Upregulated hPuf-A promotes breast cancer tumorigenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...