Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.15
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 5.27364851480385E-27
Breast cancer 3099 7.0231159858043E-7
ovarian cancer 8492 4.27049876984887E-5
malignant mesothelioma 3163 1.28816216764659E-4
psoriasis 6685 1.65930863678194E-4
invasive ductal carcinoma 2950 6.89308084055831E-4
ductal carcinoma in situ 1745 9.50536654321208E-4
Disease Target Count Z-score Confidence
Shipyard eye 14 4.484 2.2

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.600 0.000
Breast cancer 1.600 0.000
breast carcinoma 1.200 0.000
ductal carcinoma in situ 1.200 0.001
invasive ductal carcinoma 1.900 0.001
ovarian cancer 1.500 0.000

Synonym

Accession Q14657 Q5HY39 Q8IZ78
Symbols CVG5
ESO3
Pcc1
ITBA2
DXS9879E
DXS9951E

Gene

  Ortholog (1)

Species Source
Mouse OMA Inparanoid

AA Sequence

MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFP      1 - 70
TPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPP     71 - 140
VSR                                                                       141 - 143
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384295 2002 A new member of the NY-ESO-1 gene family is ubiquitously expressed in somatic tissues and evolutionarily conserved.
More...