Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.35125228217159E-7
cystic fibrosis 1670 1.27172321331384E-5
ovarian cancer 8492 2.17770393656093E-5
osteosarcoma 7933 0.00115251275243146
breast carcinoma 1614 0.00540056645490555

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.730 0.001
cystic fibrosis 1.189 0.000
breast carcinoma 1.100 0.005
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q14656 B2RC47 Q6IAV7
Symbols ITBA1
CXorf12
DXS9878E

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLS      1 - 70
WLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPW     71 - 140
LFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLC    141 - 210
DHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR                       211 - 261
//

Text Mined References (7)

PMID Year Title
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
8786131 1996 Characterization and fine localization of two new genes in Xq28 using the genomic sequence/EST database screening approach.
8661027 1996 The complete sequence of the host cell factor 1 (HCFC1) gene and its promoter: a role for YY1 transcription factor in the regulation of its expression.