Property Summary

NCBI Gene PubMed Count 277
Grant Count 462
R01 Count 272
Funding $46,664,873.74
PubMed Score 596.62
PubTator Score 524.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.235 0.006

Synonym

Accession Q14653 A8K7L2 B2RAZ3 Q5FBY1 Q5FBY2 Q5FBY4 Q7Z5G6 IRF-3
Symbols IIAE7

Gene

PANTHER Protein Class (1)

PDB

1T2K   5JEJ   5JEL   5JEK   2O61   1ZOQ   5JEM   1J2F   1QWT   2O6G   2PI0   3A77   3QU6   5JEO   5JER  

Gene RIF (243)

PMID Text
26819312 the suppression of type I IFN production by HTLV-1 Tax through interaction with and inhibition of TBK1 kinase that phosphorylates IRF3
26811330 FAF1 plays a novel role in negatively regulating virus-induced IFN-beta production and the antiviral response by inhibiting the translocation of active, phosphorylated IRF3 from the cytosol to the nucleus
26719279 The authors found that Ca(2+) signaling associated with membrane perturbation and recognition of incoming viral genomes by cytosolic nucleic acid receptors are required to activate IRF3 in response to Sendai virus and human cytomegalovirus.
26692175 Study identifies crosstalk between PTEN and IRF3 in tumor suppression and innate immunity.
26611114 observations suggest IRF3 may function as a novel regulator to modulate TGF-beta1-induced LX-2 proliferation, at least in part, via AKT signaling pathway
26289783 the LxxLL motifs of IRF3 binds within the hydrophobic pocket of E6, precluding Ser-patch phosphorylation, necessary for IRF3 activation and interferon induction.
26216125 The identification of IRF3 deficiency in HSE provides the first description of a defect in an IFN-regulating transcription factor conferring increased susceptibility to a viral infection in the CNS in humans.
26058929 The expression levels of IRF3 were not different between CHB patients and healthy controls.
25893288 TEL-AML1 fusion protein blocks B-cell differentiation and downregulates the IRF3-IFNalpha/beta pathway by modulating expression and phosphorylation of IRF3 in human primary hematopoietic precursor cells.
25843157 The results of this study suggested that IRF3 is likely a risk gene for schizophrenia, at least in Caucasians.
More...

AA Sequence

MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDK      1 - 70
PDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDIL     71 - 140
DELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFY    141 - 210
RGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQW    211 - 280
LWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGE    281 - 350
SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD    351 - 420
FQGPGES                                                                   421 - 427
//

Text Mined References (285)

PMID Year Title
26819312 2016 Suppression of Type I Interferon Production by Human T-Cell Leukemia Virus Type 1 Oncoprotein Tax through Inhibition of IRF3 Phosphorylation.
26811330 2016 Fas-Associated Factor 1 Negatively Regulates the Antiviral Immune Response by Inhibiting Translocation of Interferon Regulatory Factor 3 to the Nucleus.
26719279 2015 Membrane Perturbation-Associated Ca2+ Signaling and Incoming Genome Sensing Are Required for the Host Response to Low-Level Enveloped Virus Particle Entry.
26692175 2016 The tumor suppressor PTEN has a critical role in antiviral innate immunity.
26611114 2016 Inhibition of IRF3 expression reduces TGF-?1-induced proliferation of hepatic stellate cells.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26289783 2015 In silico mechanistic analysis of IRF3 inactivation and high-risk HPV E6 species-dependent drug response.
26216125 2015 Functional IRF3 deficiency in a patient with herpes simplex encephalitis.
26058929 2015 Decreased Expressions of STING but not IRF3 Molecules in Chronic HBV Infected Patients.
25893288 2015 The TEL-AML1 fusion protein of acute lymphoblastic leukemia modulates IRF3 activity during early B-cell differentiation.
More...