Property Summary

NCBI Gene PubMed Count 14
PubMed Score 223.27
PubTator Score 138.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Liver neoplasms 109
Disease Target Count P-value
lung carcinoma 2844 9.21763296389941E-13
posterior fossa group A ependymoma 1511 4.78320597291243E-9
pancreatic cancer 2300 2.7550637922325E-5
lung adenocarcinoma 2714 3.5795465926846E-5
interstitial cystitis 2299 2.00984282418581E-4
pilocytic astrocytoma 3086 2.07742287007224E-4
glioblastoma 5572 7.55589326541465E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00224003384055036
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00330573848267807
nephrosclerosis 329 0.00364192546818195
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00400716962397121
nasopharyngeal carcinoma 1056 0.00988058901830747
ductal carcinoma in situ 1745 0.0121620565517399
spina bifida 1064 0.0309124601121557

Expression

Synonym

Accession Q14651 A8K2Q1 D3DNG3 Q8NEG6
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with plastin 1 (PLS1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12119179 HIV-1 gp41 is identified to have a physical interaction with plastin 1 (PLS1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGK      1 - 70
ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSYSEEEKVAFVNWINKALENDP     71 - 140
DCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAINKKKLTPFTISENLNLALNSASAIGCTV    141 - 210
VNIGASDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHL    211 - 280
TNAGWHTISNFSQDIKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQF    281 - 350
VTPADVVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSD    351 - 420
LADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNST    421 - 490
LTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAI    491 - 560
APNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK     561 - 629
//

Text Mined References (19)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...