Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.07
PubTator Score 20.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.03509977901195E-19
medulloblastoma, large-cell 6234 9.69998429220787E-7
osteosarcoma 7933 1.30105225193483E-5
atypical teratoid / rhabdoid tumor 4369 2.17446390875559E-5
pituitary cancer 1972 1.09817176331728E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.20760948410979E-4
group 4 medulloblastoma 1875 3.64414107316593E-4
ductal carcinoma in situ 1745 0.00178365680731967
invasive ductal carcinoma 2950 0.00235601019125855
diabetes mellitus 1663 0.0035123615382199
Gaucher disease type 1 171 0.0164014319819885
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0186978338056136
Disease Target Count Z-score Confidence
Pseudomyxoma peritonei 6 3.23 1.6
Mature teratoma 3 3.225 1.6
Dermoid cyst 5 3.22 1.6

Expression

Synonym

Accession Q14644 A6NL15 F8W6X8 Q8IUY2
Symbols GAPIII
GAP1IP4BP

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (4)

PMID Text
25294679 the function of RASA3 during megakaryopoiesis, megakaryocyte adhesion and migration as well as integrin signaling has been reported.
19433443 model in which the Ras GAP-related domain of GAP1(IP4BP) functions to stabilize the switch II region of Rap1, allowing stabilization of the transition state during GTP hydrolysis initiated by the arginine finger
12356770 role in intracellular calcium homeostasis
7637787 GAP1IP4BP is an inositol 1,3,4,5-tetrakisphosphate regulated plasma membrane associated Ras and Rap GAP. Membrane association results from its PH domain binding phosphatidylinositol 4,5-bisphosphate.

AA Sequence

MAVEDEGLRVFQSVKIKIGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEIP      1 - 70
RSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDADSEVQGKVHLELRLSEVITDT     71 - 140
GVVCHKLATRIVECQGLPIVNGQCDPYATVTLAGPFRSEAKKTKVKRKTNNPQFDEVFYFEVTRPCSYSK    141 - 210
KSHFDFEEEDVDKLEIRVDLWNASNLKFGDEFLGELRIPLKVLRQSSSYEAWYFLQPRDNGSKSLKPDDL    211 - 280
GSLRLNVVYTEDHVFSSDYYSPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAVPLVRLFLHYGRVVP    281 - 350
FISAIASAEVKRTQDPNTIFRGNSLASKCIDETMKLAGMHYLHVTLKPAIEEICQSHKPCEIDPVKLKDG    351 - 420
ENLENNMENLRQYVDRVFHAITESGVSCPTVMCDIFFSLREAAAKRFQDDPDVRYTAVSSFIFLRFFAPA    421 - 490
ILSPNLFQLTPHHTDPQTSRTLTLISKTVQTLGSLSKSKSASFKESYMATFYEFFNEQKYADAVKNFLDL    491 - 560
ISSSGRRDPKSVEQPIVLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNHEFTYHKSKGDQPLYSIPIENIL    561 - 630
AVEKLEEESFKMKNMFQVIQPERALYIQANNCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCR    631 - 700
APSDSAPGCSPCTGGLPANIQLDIDGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVI    701 - 770
DDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI          771 - 834
//

Text Mined References (27)

PMID Year Title
25294679 2015 The Ras/Rap GTPase activating protein RASA3: from gene structure to in vivo functions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23221813 The scat mouse model highlights RASA3, a GTPase activating protein, as a key regulator of vertebrate erythropoiesis and megakaryopoiesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19433443 2009 The ability of GAP1IP4BP to function as a Rap1 GTPase-activating protein (GAP) requires its Ras GAP-related domain and an arginine finger rather than an asparagine thumb.
18952607 2008 GAP1(IP4BP)/RASA3 mediates Galphai-induced inhibition of mitogen-activated protein kinase.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...