Property Summary

NCBI Gene PubMed Count 21
PubMed Score 40.80
PubTator Score 20.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 2.2e-05
diabetes mellitus -1.300 3.5e-03
ductal carcinoma in situ -1.300 1.8e-03
Gaucher disease type 1 -1.200 1.6e-02
group 3 medulloblastoma -1.300 1.9e-03
intraductal papillary-mucinous adenoma (... 1.500 2.2e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
invasive ductal carcinoma -1.700 2.4e-03
lung carcinoma -1.400 4.0e-19
medulloblastoma, large-cell -1.900 9.7e-07
osteosarcoma -2.074 1.3e-05
pituitary cancer -1.400 1.1e-04

Gene RIF (5)

AA Sequence

MAVEDEGLRVFQSVKIKIGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEIP      1 - 70
RSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDADSEVQGKVHLELRLSEVITDT     71 - 140
GVVCHKLATRIVECQGLPIVNGQCDPYATVTLAGPFRSEAKKTKVKRKTNNPQFDEVFYFEVTRPCSYSK    141 - 210
KSHFDFEEEDVDKLEIRVDLWNASNLKFGDEFLGELRIPLKVLRQSSSYEAWYFLQPRDNGSKSLKPDDL    211 - 280
GSLRLNVVYTEDHVFSSDYYSPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAVPLVRLFLHYGRVVP    281 - 350
FISAIASAEVKRTQDPNTIFRGNSLASKCIDETMKLAGMHYLHVTLKPAIEEICQSHKPCEIDPVKLKDG    351 - 420
ENLENNMENLRQYVDRVFHAITESGVSCPTVMCDIFFSLREAAAKRFQDDPDVRYTAVSSFIFLRFFAPA    421 - 490
ILSPNLFQLTPHHTDPQTSRTLTLISKTVQTLGSLSKSKSASFKESYMATFYEFFNEQKYADAVKNFLDL    491 - 560
ISSSGRRDPKSVEQPIVLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNHEFTYHKSKGDQPLYSIPIENIL    561 - 630
AVEKLEEESFKMKNMFQVIQPERALYIQANNCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCR    631 - 700
APSDSAPGCSPCTGGLPANIQLDIDGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVI    701 - 770
DDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI          771 - 834
//

Text Mined References (29)

PMID Year Title