Property Summary

Ligand Count 7
NCBI Gene PubMed Count 162
PubMed Score 565.61
PubTator Score 210.14

Knowledge Summary

Patent (6,623)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Ataxic cerebral palsy 7 4.222 2.1
3p- syndrome 21 3.246 1.6

Expression

  Differential Expression (26)

Disease log2 FC p
lung cancer -2.000 8.7e-04
Breast cancer -1.900 8.4e-08
adult high grade glioma -2.700 2.6e-04
astrocytic glioma -3.000 4.1e-03
Astrocytoma, Pilocytic -2.400 1.5e-06
atypical teratoid / rhabdoid tumor -4.200 7.9e-09
colon cancer -1.200 2.4e-02
cystic fibrosis 1.710 6.1e-05
ependymoma -2.600 2.6e-02
glioblastoma -2.600 4.8e-08
group 3 medulloblastoma -4.400 3.4e-05
intraductal papillary-mucinous carcinoma... -2.000 3.2e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.6e-02
lung adenocarcinoma -1.200 2.0e-09
lung carcinoma -1.600 1.0e-28
malignant mesothelioma -1.600 8.0e-07
medulloblastoma, large-cell -5.200 9.0e-08
oligodendroglioma -2.000 4.5e-02
ovarian cancer -2.200 4.0e-06
Pick disease -1.300 3.3e-02
primitive neuroectodermal tumor -3.900 2.2e-05
psoriasis -1.600 3.4e-04
spina bifida -1.629 4.4e-02
subependymal giant cell astrocytoma -1.522 2.9e-02
ulcerative colitis 1.800 3.2e-05
Waldenstrons macroglobulinemia -2.037 2.8e-03

Gene RIF (100)

AA Sequence

MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKLCPMNRYSAQK      1 - 70
QFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPA     71 - 140
LLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEVN    141 - 210
SVNCNTSWKIVLFMKWSDNKDDILKGGDVVRLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKA    211 - 280
LWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEK    281 - 350
MVYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT    351 - 420
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNS    421 - 490
GQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL    491 - 560
RHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRF    561 - 630
LDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLF    631 - 700
WRDSNKEIRSKSVRELAQDAKEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMS    701 - 770
DENLPYDLRASFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF    771 - 840
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKM    841 - 910
AKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEPEKEDIMVMDT    911 - 980
KLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEGPSNVPGALDFEHIEEQAEGI    981 - 1050
FGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVD   1051 - 1120
NYKQIKQDLDQLRSIVEKSELWVYKGQGPDETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEIL   1121 - 1190
IRLSKLCVQESASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ   1191 - 1260
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG   1261 - 1330
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVELLAVCTEGKNV   1331 - 1400
YTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRA   1401 - 1470
CNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKA   1471 - 1540
SVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNII   1541 - 1610
ERLQDIVSALEDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL   1611 - 1680
CIKVLQTLREMMTKDRGYGEKLISIDELDNAELPPAPDSENATEELEPSPPLRQLEDHKRGEALRQVLVN   1681 - 1750
RYYGNVRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSRGEMSLAEVQCHLDKEGASNLVIDLI   1751 - 1820
MNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDL   1821 - 1890
GNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADK   1891 - 1960
AKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLG   1961 - 2030
LYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNA   2031 - 2100
SKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQ   2101 - 2170
LARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTE   2171 - 2240
RDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRG   2241 - 2310
GTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSF   2311 - 2380
VGNCGTFTRGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSII   2381 - 2450
LTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPRE   2451 - 2520
ELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVL   2521 - 2590
NLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKD   2591 - 2660
STEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQ   2661 - 2730
MTEQRKQKQRIGLLGHPPHMNVNPQQPA                                             2731 - 2758
//

Text Mined References (168)

PMID Year Title