Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.05
PubTator Score 16.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
lung adenocarcinoma 2714 9.52184714620471E-23
astrocytoma 1493 3.55874608892715E-13
oligodendroglioma 2849 1.40093941083818E-9
adult high grade glioma 2148 1.22630222681608E-5
colon cancer 1475 3.13558426481545E-5
atypical teratoid / rhabdoid tumor 4369 7.49370719389341E-5
medulloblastoma, large-cell 6234 9.88665767924287E-5
pilocytic astrocytoma 3086 1.17892446801784E-4
group 4 medulloblastoma 1875 1.57682695704456E-4
glioblastoma 5572 2.10084284418532E-4
ulcerative colitis 2087 4.73122592217174E-4
Pick disease 1893 6.69236674814993E-4
osteosarcoma 7933 0.00100467299174729
ovarian cancer 8492 0.00429514402574667
cutaneous lupus erythematosus 1056 0.010631139273838
subependymal giant cell astrocytoma 2287 0.0181928728003078
spina bifida 1064 0.0367449651877039
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 19 3.447 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 0.011
astrocytoma -1.100 0.000
glioblastoma -1.700 0.000
oligodendroglioma -1.100 0.000
osteosarcoma 1.646 0.001
group 4 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -2.300 0.000
colon cancer -1.400 0.000
lung adenocarcinoma -1.300 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -2.836 0.018
spina bifida -1.270 0.037
Pick disease -1.100 0.001
ulcerative colitis -1.200 0.000
ovarian cancer 1.700 0.004

Synonym

Accession Q14642 D3DXI3 Q14640 Q5JSF1 5PTase
Symbols 5PTASE

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (2)

PMID Text
26051944 The ataxic phenotype and characteristics neurodegeneration of the Inpp5a Gt(OST50073)Lex mouse indicate a crucial role for Inpp5a in purkinje cells survival.
20876729 NPP5Amay play a role in development and progression of cutaneous squamous cell carcinoma tumors

AA Sequence

MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDK      1 - 70
FVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTL     71 - 140
ESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKAL    141 - 210
GYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQ    211 - 280
LEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDR    281 - 350
ILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ            351 - 412
//

Text Mined References (15)

PMID Year Title
26051944 2015 Deletion of Inpp5a causes ataxia and cerebellar degeneration in mice.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20876729 2010 Loss of inositol polyphosphate 5-phosphatase is an early event in development of cutaneous squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14996095 2004 SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11210186 2001 Cloning, expression and chromosomal location of NKX6B TO 10Q26, a region frequently deleted in brain tumors.
9398266 1997 Activation of the 43 kDa inositol polyphosphate 5-phosphatase by 14-3-3zeta.
More...