Property Summary

NCBI Gene PubMed Count 15
PubMed Score 28.67
PubTator Score 25.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 1.7
Disease Target Count Z-score Confidence
Chromosome 9p deletion syndrome 13 4.457 2.2
Placenta accreta 5 4.44 2.2

Gene RIF (4)

AA Sequence

MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVST      1 - 70
SNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT      71 - 139
//

Text Mined References (16)

PMID Year Title