Property Summary

NCBI Gene PubMed Count 15
Grant Count 12
R01 Count 7
Funding $860,890.51
PubMed Score 28.57
PubTator Score 25.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (4)

PMID Text
23302396 Report decreased INSL4 gene expression in both the invasive and the noninvasive areas of villous trophoblast in patients with placenta accreta.
18035692 A tight interaction between HER-2 gene and EPIL in invasive breast cancer cells is probable.
15958731 Expression of the INSL4 gene was doubled in the placenta of the growth-restricted twin compared to the normally grown sibling, suggesting that it may be linked to a higher level of apoptosis and loss of cell viability
12606452 We identified an INSL4 alternatively spliced mRNA species that encodes putative novel INSL4-like peptides.

AA Sequence

MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVST      1 - 70
SNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT      71 - 139
//

Text Mined References (16)

PMID Year Title
23302396 2013 Relaxin, its receptor (RXFP1), and insulin-like peptide 4 expression through gestation and in placenta accreta.
19915573 2009 A genome-wide association study identifies three new susceptibility loci for ulcerative colitis in the Japanese population.
18035692 2005 [Expression of early placenta insulin-like growth factor (EPIL) in breast cancer cells provides an autocrine loop with enhancement of predominantly HER-2-related invasivity].
15958731 2005 Early placental insulin-like protein (INSL4 or EPIL) in placental and fetal membrane growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12606452 2003 Placenta-specific INSL4 expression is mediated by a human endogenous retrovirus element.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...