Property Summary

NCBI Gene PubMed Count 70
Grant Count 137
R01 Count 78
Funding $11,596,583.89
PubMed Score 14.06
PubTator Score 134.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
nephrosclerosis 1.193 0.037
interstitial lung disease 2.400 0.014
malignant mesothelioma -1.800 0.000
astrocytic glioma -2.100 0.008
oligodendroglioma -2.100 0.029
glioblastoma 2.600 0.017
sonic hedgehog group medulloblastoma -2.200 0.000
medulloblastoma, large-cell -2.100 0.002
lung cancer 4.100 0.000
interstitial cystitis 4.400 0.000
pediatric high grade glioma 2.600 0.003
ulcerative colitis 3.200 0.000

Synonym

Accession Q14627 A8K7E2 O00667 IL-13 receptor subunit alpha-2
Symbols CT19
IL-13R
IL13BP
CD213A2

Gene

PDB

3LB6  

Gene RIF (61)

PMID Text
26656559 Data indicate single-chain antibody (scFv47) as a highly selective interleukin 13 receptor subunit alpha 2 (IL13Ralpha2) targeting agent.
26208975 IL13Ralpha2 knockdown and IL-13 treatment cooperatively upregulated the metastasis suppressor tumor protein 63 (TP63) in a STAT6-dependent manner.
25514189 Expression of CXCR3 in fibroblasts is associated with the expression of IL-13Ralpha2.
25247196 In this review, we will discuss the recent advances in the IL13Ralpha2-targeted immunotherapy and evaluate the most promising strategy for targeted GBM immunotherapy. [review]
24879793 endogenously expressed IL-13Ralpha2 does not activate any unique IL-13-mediated gene expression patterns, confirming its role as a decoy receptor for IL-13 signaling.
24841514 In cytotoxicity assays, CAR T cells killed CAR T cells killed IL13Ra1- and/or IL13Ra2-positive cells in contrast to IL13Ra1- and IL13Ra2-negative controls
24747967 Study presents evidence that PNR could promote ERalpha-negative breast cancer metastasis through activation of IL-13Ralpha2-mediated signaling pathway.
24204956 IL13Ralpha2 over-expression is associated with glioma.
24056919 Results suggest that the physical interaction between the cytoplasmic domains of IL-13Ralpha2 and IL-4Ralpha regulates IL-4 signaling through the IL-4Ralpha-IL-13Ralpha1 receptor complex.
23421960 Expression of IL-13Ralpha2 in tumors was significantly decreased with IL-13-PE treatment as compared to the controls and the number of myeloid-derived suppressor cells (MDSC) was also significantly reduced in the spleens of the IL-13-PE treated mice
More...

AA Sequence

MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYE      1 - 70
LKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKV     71 - 140
QDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDF    141 - 210
YICVNGSSENKPIRSSYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDD    211 - 280
TTLVTATVENETYTLKTTNETRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGF    281 - 350
ILILVIFVTGLLLRKPNTYPKMIPEFFCDT                                            351 - 380
//

Text Mined References (72)

PMID Year Title
26656559 2015 A novel single-chain antibody redirects adenovirus to IL13R?2-expressing brain tumors.
26208975 2015 Targeting IL13Ralpha2 activates STAT6-TP63 pathway to suppress breast cancer lung metastasis.
25514189 2015 CXCR3 Requirement for the Interleukin-13-Mediated Up-Regulation of Interleukin-13R?2 in Pulmonary Fibroblasts.
25247196 2014 Interleukin-13 receptor alpha 2-targeted glioblastoma immunotherapy.
24879793 2014 Endogenously expressed IL-13R?2 attenuates IL-13-mediated responses but does not activate signaling in human lung fibroblasts.
24841514 2014 T cells redirected to interleukin-13R?2 with interleukin-13 mutein--chimeric antigen receptors have anti-glioma activity but also recognize interleukin-13R?1.
24747967 2015 IL-13R?2 mediates PNR-induced migration and metastasis in ER?-negative breast cancer.
24204956 2013 Glioma IL13R?2 is associated with mesenchymal signature gene expression and poor patient prognosis.
24056919 2013 The association of the cytoplasmic domains of interleukin 4 receptor alpha and interleukin 13 receptor alpha 2 regulates interleukin 4 signaling.
23421960 2013 Targeting of interleukin-13 receptor ?2 for treatment of head and neck squamous cell carcinoma induced by conditional deletion of TGF-? and PTEN signaling.
More...