Property Summary

NCBI Gene PubMed Count 70
PubMed Score 14.06
PubTator Score 134.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 7.71410391030315E-7
ulcerative colitis 2087 5.99956644508789E-6
malignant mesothelioma 3163 9.49279479421527E-6
sonic hedgehog group medulloblastoma 1482 6.62237901838333E-5
interstitial cystitis 2299 1.64377479647189E-4
medulloblastoma, large-cell 6234 0.00247893814763748
pediatric high grade glioma 2712 0.0033749544017634
astrocytic glioma 2241 0.00809175736890789
interstitial lung disease 292 0.0135866187823941
glioblastoma 5572 0.0165878074073524
oligodendroglioma 2849 0.028956629505183
nephrosclerosis 329 0.0368251818588242
Disease Target Count Z-score Confidence
Malignant glioma 23 3.07 1.5

Expression

  Differential Expression (12)

Disease log2 FC p
nephrosclerosis 1.193 0.037
interstitial lung disease 2.400 0.014
malignant mesothelioma -1.800 0.000
astrocytic glioma -2.100 0.008
oligodendroglioma -2.100 0.029
glioblastoma 2.600 0.017
sonic hedgehog group medulloblastoma -2.200 0.000
medulloblastoma, large-cell -2.100 0.002
lung cancer 4.100 0.000
interstitial cystitis 4.400 0.000
pediatric high grade glioma 2.600 0.003
ulcerative colitis 3.200 0.000

Synonym

Accession Q14627 A8K7E2 O00667 IL-13 receptor subunit alpha-2
Symbols CT19
IL-13R
IL13BP
CD213A2

Gene

PDB

3LB6  

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (61)

PMID Text
26656559 Data indicate single-chain antibody (scFv47) as a highly selective interleukin 13 receptor subunit alpha 2 (IL13Ralpha2) targeting agent.
26208975 IL13Ralpha2 knockdown and IL-13 treatment cooperatively upregulated the metastasis suppressor tumor protein 63 (TP63) in a STAT6-dependent manner.
25514189 Expression of CXCR3 in fibroblasts is associated with the expression of IL-13Ralpha2.
25247196 In this review, we will discuss the recent advances in the IL13Ralpha2-targeted immunotherapy and evaluate the most promising strategy for targeted GBM immunotherapy. [review]
24879793 endogenously expressed IL-13Ralpha2 does not activate any unique IL-13-mediated gene expression patterns, confirming its role as a decoy receptor for IL-13 signaling.
24841514 In cytotoxicity assays, CAR T cells killed CAR T cells killed IL13Ra1- and/or IL13Ra2-positive cells in contrast to IL13Ra1- and IL13Ra2-negative controls
24747967 Study presents evidence that PNR could promote ERalpha-negative breast cancer metastasis through activation of IL-13Ralpha2-mediated signaling pathway.
24204956 IL13Ralpha2 over-expression is associated with glioma.
24056919 Results suggest that the physical interaction between the cytoplasmic domains of IL-13Ralpha2 and IL-4Ralpha regulates IL-4 signaling through the IL-4Ralpha-IL-13Ralpha1 receptor complex.
23421960 Expression of IL-13Ralpha2 in tumors was significantly decreased with IL-13-PE treatment as compared to the controls and the number of myeloid-derived suppressor cells (MDSC) was also significantly reduced in the spleens of the IL-13-PE treated mice
More...

AA Sequence

MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYE      1 - 70
LKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKV     71 - 140
QDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDF    141 - 210
YICVNGSSENKPIRSSYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDD    211 - 280
TTLVTATVENETYTLKTTNETRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGF    281 - 350
ILILVIFVTGLLLRKPNTYPKMIPEFFCDT                                            351 - 380
//

Text Mined References (72)

PMID Year Title
26656559 2015 A novel single-chain antibody redirects adenovirus to IL13R?2-expressing brain tumors.
26208975 2015 Targeting IL13Ralpha2 activates STAT6-TP63 pathway to suppress breast cancer lung metastasis.
25514189 2015 CXCR3 Requirement for the Interleukin-13-Mediated Up-Regulation of Interleukin-13R?2 in Pulmonary Fibroblasts.
25247196 2014 Interleukin-13 receptor alpha 2-targeted glioblastoma immunotherapy.
24879793 2014 Endogenously expressed IL-13R?2 attenuates IL-13-mediated responses but does not activate signaling in human lung fibroblasts.
24841514 2014 T cells redirected to interleukin-13R?2 with interleukin-13 mutein--chimeric antigen receptors have anti-glioma activity but also recognize interleukin-13R?1.
24747967 2015 IL-13R?2 mediates PNR-induced migration and metastasis in ER?-negative breast cancer.
24204956 2013 Glioma IL13R?2 is associated with mesenchymal signature gene expression and poor patient prognosis.
24056919 2013 The association of the cytoplasmic domains of interleukin 4 receptor alpha and interleukin 13 receptor alpha 2 regulates interleukin 4 signaling.
23421960 2013 Targeting of interleukin-13 receptor ?2 for treatment of head and neck squamous cell carcinoma induced by conditional deletion of TGF-? and PTEN signaling.
More...