Property Summary

NCBI Gene PubMed Count 74
PubMed Score 16.18
PubTator Score 134.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Brain Injuries 65 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Malignant glioma 26 3.265 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.800 1.8e-02
astrocytic glioma -2.100 8.1e-03
glioblastoma 1.900 1.8e-02
group 3 medulloblastoma -1.500 3.6e-02
interstitial cystitis 4.400 1.6e-04
interstitial lung disease 2.400 1.4e-02
lung cancer 4.100 7.7e-07
malignant mesothelioma -1.800 9.5e-06
medulloblastoma, large-cell -2.100 2.5e-03
nephrosclerosis 1.193 3.7e-02
oligodendroglioma -2.100 2.9e-02
ulcerative colitis 3.200 6.0e-06

Gene RIF (64)

AA Sequence

MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYE      1 - 70
LKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKV     71 - 140
QDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDF    141 - 210
YICVNGSSENKPIRSSYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDD    211 - 280
TTLVTATVENETYTLKTTNETRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGF    281 - 350
ILILVIFVTGLLLRKPNTYPKMIPEFFCDT                                            351 - 380
//

Text Mined References (75)

PMID Year Title