Property Summary

NCBI Gene PubMed Count 38
Grant Count 18
R01 Count 4
Funding $1,330,826.58
PubMed Score 9.26
PubTator Score 36.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
oligodendroglioma 1.500 0.013
psoriasis -1.100 0.000
tuberculosis and treatment for 3 months 1.300 0.000
non-small cell lung cancer -1.180 0.000
lung cancer -1.300 0.000
active Crohn's disease -1.037 0.006
breast carcinoma -1.300 0.000
group 4 medulloblastoma -1.300 0.000
posterior fossa group A ependymoma 1.900 0.000
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma -1.800 0.000
non-inflammatory breast cancer -2.400 0.000
ductal carcinoma in situ -1.300 0.001
ovarian cancer -1.400 0.001

Gene RIF (25)

PMID Text
26876177 Proteolysis of the IL-11R represents a molecular switch that controls the IL-11 trans-signaling pathway which is the target in intestinal tumorigenesis, lung carcinomas, and asthma.
25524575 These results indicate that IL-11Ralpha is a potential target for the development of molecular targeted therapy and noninvasive tumor imaging in human osteosarcoma.
22433466 Constructed a designer cytokine Hyper IL-11 (H11), which is exclusively composed of naturally existing components. It contains the full length sIL-11Ralpha connected with the mature IL-11 protein, and acts as an agonist on cells expressing the gp130 molec
22075555 data suggest that IL-11Ralpha-CAR T cells may represent a new therapy for patients with osteosarcoma pulmonary metastases
21982075 IL11RA promoter polymorphism--rs1061758--may be associated with the risk of papillary thyroid cancer in the Korean population.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20553623 IL11 as well as IL11RA are likely to play a role in the progression of endometrial carcinoma.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQG      1 - 70
PDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGL     71 - 140
PTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDV    141 - 210
SLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVI    211 - 280
TDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSL    281 - 350
QPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP    351 - 420
NL                                                                        421 - 422
//

Text Mined References (39)

PMID Year Title
26876177 2016 Proteolytic Cleavage Governs Interleukin-11 Trans-signaling.
25524575 2015 Interleukin-11 receptor ? is overexpressed in human osteosarcoma, and near-infrared-labeled IL-11R? imaging agent could detect osteosarcoma in mouse tumor xenografts.
22433466 2012 A designer hyper interleukin 11 (H11) is a biologically active cytokine.
22075555 2012 Genetically modified T cells targeting interleukin-11 receptor ?-chain kill human osteosarcoma cells and induce the regression of established osteosarcoma lung metastases.
21982075 2012 Associations between promoter polymorphism -106A/G of interleukin-11 receptor alpha and papillary thyroid cancer in Korean population.
21741611 2011 Inactivation of IL11 signaling causes craniosynostosis, delayed tooth eruption, and supernumerary teeth.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20553623 2010 Interleukin 11 is upregulated in uterine lavage and endometrial cancer cells in women with endometrial carcinoma.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
More...