Property Summary

Ligand Count 1
NCBI Gene PubMed Count 41
PubMed Score 9.36
PubTator Score 36.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease -1.037 6.0e-03
Breast cancer -1.700 1.1e-25
breast carcinoma -1.300 1.8e-05
ductal carcinoma in situ -1.300 5.9e-04
group 4 medulloblastoma -1.300 2.5e-04
invasive ductal carcinoma -1.151 2.1e-03
lung adenocarcinoma -1.100 4.1e-16
lung cancer -1.300 1.2e-04
non-small cell lung cancer -1.180 5.1e-16
oligodendroglioma 1.500 1.3e-02
ovarian cancer -1.400 7.7e-04
posterior fossa group A ependymoma 1.900 8.3e-08
psoriasis -1.100 8.7e-07
tuberculosis 1.100 2.2e-04

Protein-protein Interaction (1)

Gene RIF (28)

AA Sequence

MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQG      1 - 70
PDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGL     71 - 140
PTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDV    141 - 210
SLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVI    211 - 280
TDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSL    281 - 350
QPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP    351 - 420
NL                                                                        421 - 422
//

Text Mined References (42)

PMID Year Title