Property Summary

NCBI Gene PubMed Count 87
Grant Count 323
R01 Count 195
Funding $29,846,001.37
PubMed Score 390.91
PubTator Score 59.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.500 0.000
osteosarcoma 2.035 0.000
active Crohn's disease -1.540 0.008
ulcerative colitis -1.400 0.000

Synonym

Accession Q14623 B9EGM5 O43322 Q8N4B9 IHH
Symbols BDA1
HHG2

Gene

IHH

PDB

3N1M   3N1P   3N1F   3K7G   3K7H   3K7I   3K7J   3N1O  

Gene RIF (69)

PMID Text
26963384 The Annexin a2 Promotes Development in Arthritis through Neovascularization by Amplification Hedgehog Pathway.
26705100 Our results show for the first time that Indian hedgehog does not cause extracellular matrix degradation in healthy ex vivo cartilage or in the presence of IL-1beta
26691363 The serum levels of IHH and SHH were significantly higher in autistic subjects than those of control subjects. The findings support a correlation between SHH, IHH and BDNF in autistic children, suggesting their pathological role in autism.
26201092 Data show that the Hh (Hedgehog) signalling pathway mediates chemoresistance of BCSCs (breast cancer stem cells) and contributes to the outcome in breast cancer patients.
25958162 Findings demonstrated that Ihh promotes human cartilage endplate degeneration.
25888497 Data suggest that hedgehog (HH) signaling through transcription factors GLI1 and GLI2 could be required for the maintenance of pregnancy.
25692887 Duplication of the upstream IHH regulatory region and a correlation between the phenotype and the implicated regulatory regions in a family with craniosynostosis Philadelphia type.
25519748 endogenously produced IHH is playing a critical role in regulating hBMSC chondrogenesis.
24991722 Studies indicate that the hedgehog (Hh) signaling pathway has become one of the most studied potential therapeutic targets in hematological malignancies.
24844414 Indian Hedgehog, a critical modulator in osteoarthritis, could be a potential therapeutic target for attenuating cartilage degeneration disease.
More...

AA Sequence

MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGK      1 - 70
IARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHS     71 - 140
EESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQV    141 - 210
RLESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTA    211 - 280
DNHTEPAARFRATFASHVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVVASCFAA    281 - 350
VADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS             351 - 411
//

Text Mined References (89)

PMID Year Title
26963384 2016 The Annexin a2 Promotes Development in Arthritis through Neovascularization by Amplification Hedgehog Pathway.
26705100 2015 Hedgehog signalling does not stimulate cartilage catabolism and is inhibited by Interleukin-1?.
26691363 2015 Correlation Between Hedgehog (Hh) Protein Family and Brain-Derived Neurotrophic Factor (BDNF) in Autism Spectrum Disorder (ASD).
26201092 2015 The Hedgehog signalling pathway mediates drug response of MCF-7 mammosphere cells in breast cancer patients.
25958162 2015 Indian hedgehog contributes to human cartilage endplate degeneration.
25888497 2015 Hedgehog signaling through GLI1 and GLI2 is required for epithelial-mesenchymal transition in human trophoblasts.
25692887 2015 Identification of the fourth duplication of upstream IHH regulatory elements, in a family with craniosynostosis Philadelphia type, helps to define the phenotypic characterization of these regulatory elements.
25519748 2015 Endogenously produced Indian Hedgehog regulates TGF?-driven chondrogenesis of human bone marrow stromal/stem cells.
24991722 2015 New insight into hedgehog signaling in hematological malignancies.
24844414 2014 Indian Hedgehog, a critical modulator in osteoarthritis, could be a potential therapeutic target for attenuating cartilage degeneration disease.
More...